Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate BPHYT_RS29175 BPHYT_RS29175 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__BFirm:BPHYT_RS29175 Length = 390 Score = 263 bits (673), Expect = 5e-75 Identities = 156/366 (42%), Positives = 215/366 (58%), Gaps = 20/366 (5%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIG 63 + + +LT + G +++L LD+ EF+VL+GPSGCGKST L +AGL T G I I Sbjct: 37 VAVRNLTIQLGANTVIENLDLDVQAGEFVVLLGPSGCGKSTLLHSIAGLIDVTDGSIEIA 96 Query: 64 GDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETLG 123 G+ M + P++R IA+VFQ YALYP M+V +N+ F L G AE RV +E L Sbjct: 97 GEDMTWADPKDRRIALVFQSYALYPTMSVERNLSFALRIN-GTPKAEIARRVARASEMLQ 155 Query: 124 IADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQDQ 183 + LL RKP +LSGGQ+QRVA+GRAIVR+ +VFL DEPLSNLDAKLR E+R EL+ L + Sbjct: 156 LGPLLKRKPAQLSGGQRQRVAIGRAIVREADVFLFDEPLSNLDAKLRTELRRELKQLHQR 215 Query: 184 LAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMINLV 243 L T +YVTH+Q EAMT+A R+AVM G +QQ +P E Y P+NLFVA F+G P +NL+ Sbjct: 216 LGATMIYVTHDQVEAMTLATRMAVMRGGVIQQFGTPAEVYARPDNLFVATFLGTPAMNLI 275 Query: 244 RG---TRSEST-FVGEHFSYPLDEDVMESVDDRD-DFVLGVRPEDIEVADAAPDDAALDD 298 +G TR + F EH+ + + VLGVR ED+ +A+ A + A Sbjct: 276 KGRLETRDGALHFCTEHWRLDVSRYPFRTTPANGLPCVLGVRAEDVRLAEGASEHA---- 331 Query: 299 HDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDKIHL 358 V++VEP G+ V+ L + A ++ + + GD + + L Sbjct: 332 -----KVSLVEPMGNHRVIWLDYHGVQVA-----SIDQTKTPLAIGDAAAFSFDSTHVSL 381 Query: 359 FDAETG 364 FD G Sbjct: 382 FDEAGG 387 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 390 Length adjustment: 30 Effective length of query: 353 Effective length of database: 360 Effective search space: 127080 Effective search space used: 127080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory