Align Xylose/arabinose-binding protein XylF (characterized, see rationale)
to candidate BPHYT_RS30855 BPHYT_RS30855 sugar ABC transporter substrate-binding protein
Query= uniprot:Q4J710 (402 letters) >FitnessBrowser__BFirm:BPHYT_RS30855 Length = 362 Score = 318 bits (816), Expect = 1e-91 Identities = 173/315 (54%), Positives = 215/315 (68%), Gaps = 16/315 (5%) Query: 77 GQVPEHPTWKIVFINHVTTNPFFVPTQYGIQDACLLLDCNYQWTGSETSDTTTMVNDMEA 136 G P H WKIVF+NHVTTNPFFVPTQYGIQDA LL +YQWTGS +D MVN + A Sbjct: 47 GSFPAHKRWKIVFVNHVTTNPFFVPTQYGIQDATALLGMDYQWTGSANADIGEMVNAVNA 106 Query: 137 AISQGANGIAVSVISPNAFDKPTQDALNAGIPVFAYNAYIPTDDPSYSQYHNPPYLGYIG 196 AI+ A+ IAV ++ P AFDKP Q AL+AGIPVFAYNA D PS S P L YIG Sbjct: 107 AIAAKADAIAVPIVDPKAFDKPIQAALDAGIPVFAYNA----DAPSGS---TNPRLAYIG 159 Query: 197 QSLYASGQLFGQRILNLVPSGSRVALFIATPGTANIQPRIDG-IQSVIEGHYTIDV--VA 253 Q LY SG G+RI NL+ SG VALFIATPG NIQPR+DG + ++ + IDV +A Sbjct: 160 QDLYLSGYQMGERIANLIDSG-LVALFIATPGQLNIQPRLDGAVAAIKKSGKKIDVQTIA 218 Query: 254 TGALVSDEQSAIESYFNSHPDVKGMFAVDAGSTQGVGNVLREHGIKTVSNGGTIAAGGYD 313 TGA V++E S I+S++ H D+KGMFAVDAGSTQGV ++E + + + GG+D Sbjct: 219 TGATVNEELSKIKSFYLGHQDLKGMFAVDAGSTQGVAVTMKESNLPSKG----VHGGGFD 274 Query: 314 LLPATIQNIVDGYLDFTIDQQPYLQGFLPTLAIYLYLISDTLVYPLNIDTGSKFITNSNI 373 LLP T+ I +G+LDFTIDQQPY+QGF + + +L S LV P N++TG KF+T + Sbjct: 275 LLPRTVDLINEGFLDFTIDQQPYVQGFYTVVQAFTFLASGGLVGPANVNTGLKFVTKGTV 334 Query: 374 QPYL-LASRYEGSST 387 PYL ++RYEG ST Sbjct: 335 DPYLNTSTRYEGKST 349 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 362 Length adjustment: 30 Effective length of query: 372 Effective length of database: 332 Effective search space: 123504 Effective search space used: 123504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory