Align high affinity cationic amino acid transporter 1 (characterized)
to candidate BPHYT_RS01785 BPHYT_RS01785 amino acid permease
Query= CharProtDB::CH_091324 (622 letters) >FitnessBrowser__BFirm:BPHYT_RS01785 Length = 463 Score = 249 bits (635), Expect = 2e-70 Identities = 149/412 (36%), Positives = 234/412 (56%), Gaps = 29/412 (7%) Query: 18 VVDCSREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALAS 77 ++ S + + L + L DL LGVG+ +G G++VL G A + AGPA++ISFLIAA+A Sbjct: 12 MIAASAQNAGLKKALGALDLTFLGVGAIIGTGIFVLTGTGAVQ-AGPALMISFLIAAIAC 70 Query: 78 VLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFD 137 A L Y EF + +P GS Y YSY T+GEL A+I GW+L+L Y + TS+V+ WS Sbjct: 71 GFAALAYAEFASTIPVAGSIYTYSYATLGELAAWIIGWDLMLEYGLATSAVSVGWSGYLQ 130 Query: 138 ELIGKPIGEFSRQHMALN-APGVLAQTPDIF---AVIIIIILTGLLTLGVKESAMVNKIF 193 L+ G +AL APG L +F A ++++ +T LL++GV+ESA +N + Sbjct: 131 SLLS---GFGVSLPVALTAAPGALPGHDTLFNLPAFLVMMAITALLSVGVRESARINNVM 187 Query: 194 TCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAA 253 I V+V+ ++ G + NW FMP G++GV AA Sbjct: 188 VAIKVVVVLLVIGVGVFHVTPANWH--------------------PFMPNGWNGVFGAAA 227 Query: 254 TCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYF-CLDI 312 F+AF+GFD +++ EEVK+P++ +P+GI+ASL +C + Y V+A +T ++P +I Sbjct: 228 VMFFAFIGFDSVSSAAEEVKDPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPSAQFANI 287 Query: 313 DSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKIN 372 P+ A + G + + +G++ + T +L + RVI+AM+ DGLL + L++++ Sbjct: 288 SHPVSYALQVAGEKWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLPERLSRVH 347 Query: 373 NRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLR 424 R TP T G ++ L L L +L++IGTL A+S+V+ VLVLR Sbjct: 348 PRFATPFFTTWLVGIFFGLIGALVPLNVLAELINIGTLAAFSMVSIAVLVLR 399 Score = 67.4 bits (163), Expect = 1e-15 Identities = 49/146 (33%), Positives = 76/146 (52%), Gaps = 19/146 (13%) Query: 457 SQTGFLPVAEKFSLKSILSPKNVEPSKFSGLIVNISAGLLAALIITVCIVAVLGREALAE 516 S+ G LP E+ S + P+ P F+ +V I GL+ AL+ + E + Sbjct: 334 SRDGLLP--ERLSR---VHPRFATPF-FTTWLVGIFFGLIGALVPLNVLA-----ELINI 382 Query: 517 GTLWAVFVMTGSVLLCMLVTGIIWRQPESKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQ 576 GTL A +++ +VL + R+ +F+ P VPV+PVL++ ++LM+ L Sbjct: 383 GTLAAFSMVSIAVL--------VLRKTHPDLPRAFRCPGVPVVPVLAVAACLFLMVNLQA 434 Query: 577 GTWVRFAVWMLIGFTIYFGYGIWHSE 602 TWV F VW+L+G IYFGY HS+ Sbjct: 435 VTWVAFVVWLLVGMVIYFGYSRRHSK 460 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 727 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 622 Length of database: 463 Length adjustment: 35 Effective length of query: 587 Effective length of database: 428 Effective search space: 251236 Effective search space used: 251236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory