Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BPHYT_RS31745 BPHYT_RS31745 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__BFirm:BPHYT_RS31745 Length = 389 Score = 256 bits (653), Expect = 1e-72 Identities = 150/354 (42%), Positives = 208/354 (58%), Gaps = 44/354 (12%) Query: 110 IALIALLLYPMVVVAIKGPQGSLTYVDNFGIQIL----IYVMLAWGLNIVVGLAGLLDLG 165 + I + P+++ A G N+G+++L +YVMLA GLNIVVG AGLLDLG Sbjct: 28 LTAIGVTALPLLIGAAAG---------NYGVRVLDFAMLYVMLALGLNIVVGFAGLLDLG 78 Query: 166 YVAFYAVGAYSYALLSSY----------------FGLSFWVLLPLSGIFAALWGVILGFP 209 Y+AFYAVGAY+ ALL+S F +W ++P++ + AA+ G+ LG P Sbjct: 79 YIAFYAVGAYTAALLTSPHLAAHFEWIGHMWPSGFHAPYWFVMPVAMVLAAIAGICLGAP 138 Query: 210 VLRLRGDYLAIVTLAFGEIIRLVLINW---TDVTKGTFGISSIPKATLFGIPFDATAGGF 266 LRLRGDYLAIVTL FGEI+R+ + N ++T G GI+ + T+ G T Sbjct: 139 TLRLRGDYLAIVTLGFGEIVRIFMNNLDRPVNITNGPQGITGVAPVTVAGFNLSET---- 194 Query: 267 AKLFHLPISSAYYKIFLFYLILALC-MLTAYVTIRLRRMPIGRAWEALREDEIACRSLGI 325 H + + ++++Y + LC +L +V RL+ IGRAW A+REDEIA +++GI Sbjct: 195 ----HAFLGFQFTTVYMYYYVFVLCSLLVVWVCTRLQHSRIGRAWAAIREDEIAAKAMGI 250 Query: 326 NTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIA 385 NT KL AFA GA F G +G+ FA QGFVSPESF ES +LA VVLGGMG + G+ Sbjct: 251 NTRNVKLLAFAMGASFGGLSGAMFAGFQGFVSPESFTLWESVTVLACVVLGGMGHIPGVI 310 Query: 386 IAAIVMVGGTELLRE--MSFLKLIFGPDFT-PELYRMLIFGLAMVVVMLFKPRG 436 A+++ E+LR IFG E+ R L++GLAMV++ML +P G Sbjct: 311 FGAVLLAILPEILRSTMTPLQNAIFGHVIVDTEVIRQLLYGLAMVIIMLRRPEG 364 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 389 Length adjustment: 32 Effective length of query: 431 Effective length of database: 357 Effective search space: 153867 Effective search space used: 153867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory