GapMind for catabolism of small carbon sources

 

Aligments for a candidate for braF in Burkholderia phytofirmans PsJN

Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BPHYT_RS19450 BPHYT_RS19450 metal-dependent hydrolase

Query= uniprot:Q1MCU2
         (292 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS19450 BPHYT_RS19450
           metal-dependent hydrolase
          Length = 594

 Score =  195 bits (496), Expect = 2e-54
 Identities = 114/260 (43%), Positives = 157/260 (60%), Gaps = 12/260 (4%)

Query: 12  DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71
           + LL V     +FGGL+A+ND SFE K G I  LIGPNGAGK+T FN +TG  + T G I
Sbjct: 344 EDLLTVNKARKQFGGLVAVNDVSFEVKAGQIIGLIGPNGAGKSTTFNLVTGVLQATSGEI 403

Query: 72  TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131
           TF    G++  ++ L    I K   + RTFQ+++L  G+TVLEN+ +  H +       +
Sbjct: 404 TF---CGER--IDSLSSREIVKRG-IGRTFQHVKLLPGMTVLENVAIGAHLRGQAGVWRS 457

Query: 132 ILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPE 191
           ++ L      +  A  A ++ R  LE+        D AG L  G QR LEIARA+C  P 
Sbjct: 458 VVRLNSAEEARLMAEAARQIRRVGLEQ-----HMYDEAGSLALGQQRILEIARALCCDPT 512

Query: 192 LLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKI 251
           LL LDEPAAGL  +E   L  LL+ ++AE G S+LL+EHDM  VM ++D +VV+E+G +I
Sbjct: 513 LLLLDEPAAGLRYQEKLQLADLLRRLKAE-GMSVLLVEHDMDFVMNLTDRLVVMEFGTRI 571

Query: 252 SDGTPDHVKNDPRVIAAYLG 271
           ++G P  V+ DP V+ AYLG
Sbjct: 572 AEGLPQEVQQDPAVLEAYLG 591


Lambda     K      H
   0.318    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 412
Number of extensions: 24
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 292
Length of database: 594
Length adjustment: 31
Effective length of query: 261
Effective length of database: 563
Effective search space:   146943
Effective search space used:   146943
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory