Align Guanidinobutyrase; EC 3.5.3.7 (characterized)
to candidate BPHYT_RS26640 BPHYT_RS26640 agmatinase
Query= SwissProt::Q9I3S3 (319 letters) >FitnessBrowser__BFirm:BPHYT_RS26640 Length = 300 Score = 213 bits (543), Expect = 4e-60 Identities = 125/299 (41%), Positives = 171/299 (57%), Gaps = 13/299 (4%) Query: 17 FGGIATMMRLPHVQSPAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYN- 75 + G+ + MR P+ + +L +D A G+PLD+ T+ R GTRFGP +RA SV + Sbjct: 2 YAGVLSFMRRPYSR---DLTGVDVAVSGIPLDLATTFRPGTRFGPAGVRAASVQLAELGA 58 Query: 76 MATGAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPI 135 G PFD LNV D GD + N L I IL G LT GGDH IT P+ Sbjct: 59 FPWGVDPFDHLNVVDYGDCWFDAHNPLGIRDAIIAHARGILASGARMLTFGGDHYITYPL 118 Query: 136 LRAIKKKHGK-VGLVHVDAHADVNDHMFGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQ 194 L A +K+GK + L+H DAH D + + HGT F +A+ E L+D R VQIG+R Sbjct: 119 LVAHVEKYGKPLSLIHFDAHCDTWPDDNPDSLNHGTMFYKAIRERLVDPARSVQIGIRTW 178 Query: 195 GYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPG 254 +DF G R++ A + + EV VG P YL+FDID +DPA+APG Sbjct: 179 N---DDF-----MGVRILDAPWVHRNGTQAAIDEVLSIVGNAPAYLTFDIDCLDPAFAPG 230 Query: 255 TGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVL 313 TGTP GGL++ QA+EI+R ++L+G D+VEVSPPYD + T+L A+L +MLC++ Sbjct: 231 TGTPVAGGLSSAQALEIVRALGAVNLVGADVVEVSPPYDHSDVTALAAAHLASDMLCLM 289 Lambda K H 0.321 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 300 Length adjustment: 27 Effective length of query: 292 Effective length of database: 273 Effective search space: 79716 Effective search space used: 79716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory