Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate BPHYT_RS19985 BPHYT_RS19985 CoA-transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__BFirm:BPHYT_RS19985 Length = 399 Score = 249 bits (635), Expect = 1e-70 Identities = 145/404 (35%), Positives = 219/404 (54%), Gaps = 10/404 (2%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L+ +RVLDLS VLAGP+ LA LGA+VIKVE P GD R G KDA N Sbjct: 5 LAGVRVLDLSNVLAGPFCAYQLALLGAEVIKVEHPEGGDLARRLGAD--KDASARNM--G 60 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 A +++ N KQSVT++ P G+ ++REL +D+L+ENF+ G + GLD+++L+ +NP Sbjct: 61 ASFVAVNAGKQSVTLNLKDPRGKAILRELVKTADVLVENFRPGVMTRLGLDFEALREVNP 120 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 +L+YC+I+GFG G ++KR YD +IQG+ G+MS+T GD + P++VG ++D + G Sbjct: 121 KLVYCAISGFGMDGEFSKRPAYDQIIQGISGVMSVT----GDADSAPLRVGYPVSDTVGG 176 Query: 184 LYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNIV 243 L + I AAL G G+ +D+++L+ +A + N+L G P +GN + Sbjct: 177 LTAAFGICAALLDARATGHGRMLDVSMLEATLATMGWVVSNFLNAGVTPTPMGNENFTAA 236 Query: 244 PYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLIRQA 303 P F T DG + + QF ++ G+ DDPRF+ R NRA L I A Sbjct: 237 PSGTFKTGDGPLNIAANENKQFVSLCQLIGRADLLDDPRFSERNARKMNRAALKAEIEAA 296 Query: 304 TVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVA-SPI 362 + A W + +AGVP G + + ++ A P +++RG E + +V + Sbjct: 297 LARDSAANWEARFFEAGVPAGRVMSVPEILAHPHLESRGFIREFAADATTERQRVTRAGF 356 Query: 363 RLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 RL + P+L HT E L LG D+A + R GV+ Sbjct: 357 RLHDADTAPGTPAPVLSAHTREQL-AALGYDDAHIDQLRAEGVV 399 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 399 Length adjustment: 31 Effective length of query: 375 Effective length of database: 368 Effective search space: 138000 Effective search space used: 138000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory