Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate BPHYT_RS21555 BPHYT_RS21555 beta alanine--pyruvate aminotransferase
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__BFirm:BPHYT_RS21555 Length = 442 Score = 265 bits (678), Expect = 2e-75 Identities = 154/423 (36%), Positives = 228/423 (53%), Gaps = 21/423 (4%) Query: 24 PFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMR 83 PFT +Q + R++ A+G+Y ++G ++LD AGLWCVN G+GREE+V A T Q+ Sbjct: 16 PFTANRQF-KAAPRLLESAKGMYYRSTDGREVLDGCAGLWCVNAGHGREEIVAAITEQLS 74 Query: 84 ELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQ 143 L F F Q HP E A +A++ PEG++ +FFT SGSE+ DT L++ Y ++G+ Sbjct: 75 TLDFAPTF-QMGHPLAFEAATKVAELMPEGLDRIFFTNSGSESVDTALKIALAYHRSRGE 133 Query: 144 PQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQ-GDFPIPGIVHIAQPYWYGEGG-DMSPD 201 Q+ +IGR GYHG G+S+GG+ + +P + H+ + Sbjct: 134 GQRTRLIGRERGYHGVGFGGISVGGIAPNRKTFSGALLPAVDHLPHTHNLEHNAFTKGQP 193 Query: 202 EFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIA 261 +G AE+LE+ + +AA I EP+ G+ GV++PP Y K+REI K+ IL I Sbjct: 194 AWGAHLAEELERIVTLHDASTIAAVIVEPVAGSTGVLIPPQGYLQKLREICTKHGILLIF 253 Query: 262 DEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGG---- 317 DEVI FGR G+ S+Y+G PDL+ +AK + + IPMG V I + + GG Sbjct: 254 DEVITAFGRVGKATASEYFGVTPDLITMAKAINNAAIPMGAVAASRTIHDSIVNGGAQGA 313 Query: 318 -EFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEAR 376 E +HG+TYS HPVA A A+ + + + E + E+ A AP + L V + R Sbjct: 314 IELFHGYTYSAHPVATAAAVATLDLYKREGLFERA-ATLAPTFEAAAHSLRGAKHVKDVR 372 Query: 377 GVGMVAALELVKNKKTRERFTDKGVGMLCRE---HCFRNGLIMRAVGDTMIISPPLVIDP 433 +GM+A +EL D G E CF G+++R GD + SPPL+I+ Sbjct: 373 NLGMIAGVELESR--------DGAPGARAYEAFVKCFEAGVLVRFTGDILAFSPPLIINE 424 Query: 434 SQI 436 QI Sbjct: 425 EQI 427 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 442 Length adjustment: 33 Effective length of query: 423 Effective length of database: 409 Effective search space: 173007 Effective search space used: 173007 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory