Align agmatinase (EC 3.5.3.11) (characterized)
to candidate BPHYT_RS05090 BPHYT_RS05090 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__BFirm:BPHYT_RS05090 Length = 329 Score = 405 bits (1040), Expect = e-117 Identities = 198/311 (63%), Positives = 234/311 (75%) Query: 48 GPRNQPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIR 107 G R QP S + R GI +MMRLP + EG DA VGVP D+GTSNR GARFGPR+IR Sbjct: 12 GERPQPLSGNAMPRCGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNRTGARFGPRQIR 71 Query: 108 EESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTL 167 ESV+LR N +T A PF L+VADLGDV +N YNL DS + I Y +I+ C P+TL Sbjct: 72 SESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIKRIETAYDEILQHDCKPITL 131 Query: 168 GGDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKR 227 GGDHTI PIL+AI KHG VGL+HVDAH D D +GEK+ HGTPFRR V+EGLLDC R Sbjct: 132 GGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLDCDR 191 Query: 228 VVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDID 287 VVQIG+RG+ + + + R QGF VV AE CW +SLVPLM +R++MG P+YI+FDID Sbjct: 192 VVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLVPLMARIRERMGDGPVYITFDID 251 Query: 288 GLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANL 347 G+DPA+APGTGTPEIAGLT QALEIIRG +GLN+VGCDLVEV+PPYDP G TAL+ ANL Sbjct: 252 GIDPAFAPGTGTPEIAGLTVPQALEIIRGSRGLNIVGCDLVEVAPPYDPFGTTALLGANL 311 Query: 348 LFEMLCVLPKV 358 FE+LCVLP V Sbjct: 312 AFELLCVLPGV 322 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 329 Length adjustment: 29 Effective length of query: 332 Effective length of database: 300 Effective search space: 99600 Effective search space used: 99600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS05090 BPHYT_RS05090 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.7279.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-67 213.1 0.0 3.6e-67 212.9 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS05090 BPHYT_RS05090 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS05090 BPHYT_RS05090 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 212.9 0.0 3.6e-67 3.6e-67 12 274 .. 43 317 .. 32 318 .. 0.93 Alignments for each domain: == domain 1 score: 212.9 bits; conditional E-value: 3.6e-67 TIGR01230 12 eAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdaremve 80 ++ vg+P+d ts r G+r+gp +ir s+ L y+ ++ l+v+D+gd+ + + +++++ lcl|FitnessBrowser__BFirm:BPHYT_RS05090 43 GFDACFVGVPFDLGTSNRTGARFGPRQIRSESVLLRPYNMATRaAPFDSLRVADLGDVAINPYNLHDSIK 112 5578899*******************************98877588**************999*9***** PP TIGR01230 81 kieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrvl 150 +ie +e+l++ +++++GG+H+i+lp++rA+++k++k+ ++++DAH+D+ d gek+ h ++ rr++ lcl|FitnessBrowser__BFirm:BPHYT_RS05090 113 RIETAYDEILQHDCKPITLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRRAV 182 ********************************************************************** PP TIGR01230 151 elg....lnvlqigiRsg..ikeeadlarennikvlkrelede......iaevlakvldkpvyvtiDiDv 208 e g +v+qig+R e++d+ r+++ +v++ e + +a+ ++ d pvy+t+DiD+ lcl|FitnessBrowser__BFirm:BPHYT_RS05090 183 EEGlldcDRVVQIGLRGTgyAAEDFDWCRDQGFEVVQAEACWNqslvplMARIRERMGDGPVYITFDIDG 252 *99777779*******753378*************99776555466676777788899************ PP TIGR01230 209 lDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 +DPafaPG+gtpe++Glt ++l+ ++ ++vG+D+vEvaP yd tal+ a+la ell lcl|FitnessBrowser__BFirm:BPHYT_RS05090 253 IDPAFAPGTGTPEIAGLTVPQALE-IIRGSRGLNIVGCDLVEVAPPYDPFGTTALLGANLAFELLC 317 ************************.89999*********************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.27 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory