Align agmatinase (EC 3.5.3.11) (characterized)
to candidate BPHYT_RS31515 BPHYT_RS31515 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__BFirm:BPHYT_RS31515 Length = 324 Score = 288 bits (738), Expect = 1e-82 Identities = 149/308 (48%), Positives = 203/308 (65%), Gaps = 6/308 (1%) Query: 53 PPSSEFVARSVGICSMMRLP-MQATPEGL---DAALVGVPLDIGTSNRPGARFGPRRIRE 108 P + + R G+ ++MRLP M+ T + D L+GVP D GT+NRPGAR GPR++R+ Sbjct: 8 PVTGTMMPRYAGVATLMRLPHMELTNNSIKDVDIGLIGVPWDGGTTNRPGARHGPRQVRD 67 Query: 109 ESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLG 168 S M+R N S+ PF ADLGD VN +L DS I Y ++ G PL++G Sbjct: 68 ISTMVRNVNRSSNINPFGLCNCADLGDAPVNPVDLIDSLNRIAGFYDEVCKLGIAPLSVG 127 Query: 169 GDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLY-HGTPFRRCVDEGLLDCKR 227 GDH +T PI++ +A K P+G+VH DAH DT ++ G+ +Y HGTPFRR ++EGLLD KR Sbjct: 128 GDHLVTLPIMRGLA-KDRPLGMVHFDAHTDTWNRYFGDNIYTHGTPFRRAIEEGLLDPKR 186 Query: 228 VVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDID 287 VQIGIRG+ + +G RV+ ++ + ++ E R+ +G P Y++FD+D Sbjct: 187 TVQIGIRGALYNDSENDWGEREGIRVIDIDEFHAMGIDAVIQEARRVVGDGPTYVTFDVD 246 Query: 288 GLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANL 347 LDP +APGTGTPEI GLT +A +IRG +GLN+VG D+VEVSPP+DPSGNTALV A L Sbjct: 247 ALDPVFAPGTGTPEIGGLTTLEAQHMIRGLRGLNLVGGDVVEVSPPFDPSGNTALVGATL 306 Query: 348 LFEMLCVL 355 +FE+LCVL Sbjct: 307 MFEILCVL 314 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 324 Length adjustment: 29 Effective length of query: 332 Effective length of database: 295 Effective search space: 97940 Effective search space used: 97940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS31515 BPHYT_RS31515 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.16654.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-60 188.7 0.0 1.1e-59 188.3 0.0 1.1 1 lcl|FitnessBrowser__BFirm:BPHYT_RS31515 BPHYT_RS31515 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS31515 BPHYT_RS31515 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.3 0.0 1.1e-59 1.1e-59 7 274 .. 33 312 .. 27 313 .. 0.90 Alignments for each domain: == domain 1 score: 188.3 bits; conditional E-value: 1.1e-59 TIGR01230 7 eaeyeeAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGda 75 + + ++ ++ ++g+P+d t rpG+rhgp ++r++st + + + + ++l + +D+gd p+ d lcl|FitnessBrowser__BFirm:BPHYT_RS31515 33 NNSIKDVDIGLIGVPWDGGTTNRPGARHGPRQVRDISTMVRNVNRSSNiNPFGLCNCADLGDAPVNPVDL 102 45578899999***************************9999888888455999***********99**9 PP TIGR01230 76 remvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegek.lshac 144 +++++i +e+ + g ++++GG+H++tlp++r +k ++l +v+fDAHtD+ + g++ ++h + lcl|FitnessBrowser__BFirm:BPHYT_RS31515 103 IDSLNRIAGFYDEVCKLGIAPLSVGGDHLVTLPIMRGLAKD-RPLGMVHFDAHTDTWNRYFGDNiYTHGT 171 *************************************9875.89*************9888765268*** PP TIGR01230 145 vmrrvlelg....lnvlqigiRsgi..keeadlarennikvlk.relede.....iaevlakvldkpvyv 202 + rr++e g ++++qigiR + + e+d+ ++++i+v++ e++ i+e+ v d p yv lcl|FitnessBrowser__BFirm:BPHYT_RS31515 172 PFRRAIEEGlldpKRTVQIGIRGALynDSENDWGEREGIRVIDiDEFHAMgidavIQEARRVVGDGPTYV 241 *******9988889********986337799**********98545544454444888888999****** PP TIGR01230 203 tiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalel 272 t+D+D+lDP faPG+gtpe+gGlt+ e+ + + ++ ++vG DvvEv+P +d s tal a+l+ e+ lcl|FitnessBrowser__BFirm:BPHYT_RS31515 242 TFDVDALDPVFAPGTGTPEIGGLTTLEAQH-MIRGLRGLNLVGGDVVEVSPPFDPSGNTALVGATLMFEI 310 ****************************99.8999**********************************9 PP TIGR01230 273 ll 274 l lcl|FitnessBrowser__BFirm:BPHYT_RS31515 311 LC 312 85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory