Align asparaginase (EC 3.5.1.1) (characterized)
to candidate BPHYT_RS07040 BPHYT_RS07040 asparaginase
Query= BRENDA::Q9RFN5 (371 letters) >FitnessBrowser__BFirm:BPHYT_RS07040 Length = 363 Score = 444 bits (1143), Expect = e-129 Identities = 217/341 (63%), Positives = 270/341 (79%), Gaps = 1/341 (0%) Query: 16 RGGIVENSHRVHAAVVDAKGRLLYALGNPTRMTLARSAAKPAQALAILETEGVAGYGFDD 75 RG +EN+H H AVVDA GRLL + G+P+RMTLARSAAKPAQALA+LET + +GFD+ Sbjct: 15 RGASIENTHVAHVAVVDASGRLLASFGDPSRMTLARSAAKPAQALAVLETGALERFGFDE 74 Query: 76 ADIALMCASHSSEDRHIARTRAMLSKIKAEEADLRCGGHPSLSEMVNRSWIKQDFIPTAV 135 AD+ALMCASHSSE RHI RTR ML+K +A EADLRCGGHP LS+ V W+K+DF P V Sbjct: 75 ADLALMCASHSSEARHIERTRQMLAKAQASEADLRCGGHPPLSDAVYIDWLKRDFKPDGV 134 Query: 136 CSNCSGKHVGMLAGARAIGAGTDGYHLPDHPMQGRVKRTVAELCDLDAGDVEWGTDGCNL 195 CSNCSGKH GMLAGA++IGA +GY PDHP+Q RVK TVA++CDL V+W TDGCNL Sbjct: 135 CSNCSGKHAGMLAGAQSIGASMEGYERPDHPLQVRVKHTVADVCDLPDEAVQWATDGCNL 194 Query: 196 PTPAFPLDRLGRIYAKLASAADGSDAG-EGQSTRCAALAHIFRAMARHPEMVAGEGRYCT 254 PTPAFPLDRL R++AKLA+A D +G + ++R +ALA I+RAM +PE VAGEGR+CT Sbjct: 195 PTPAFPLDRLARLFAKLAAAEDEVSSGAQSVTSRTSALARIYRAMTMYPEWVAGEGRFCT 254 Query: 255 MLMRAFDGALVGKLGADASYAIGVRASDATRQLGTDGALGISVKIEDGNLEMLYAVVTEL 314 LM+AFDGALVGK+GAD SYAIGVRAS+ T++ G GALG +VKIEDGN+ +LYAVV E+ Sbjct: 255 QLMQAFDGALVGKVGADGSYAIGVRASEQTKRAGAQGALGFAVKIEDGNVGILYAVVAEV 314 Query: 315 LERLGIGSPDVRSQLASFHHPQRVNTMGVTTGGVSFPFKLR 355 L L IG+P+ R++LA+FH P+ +NTMG+ T ++F L+ Sbjct: 315 LALLEIGTPEQRAKLAAFHAPKMLNTMGIQTSRITFSVALQ 355 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 363 Length adjustment: 30 Effective length of query: 341 Effective length of database: 333 Effective search space: 113553 Effective search space used: 113553 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory