Align Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; EC 3.5.1.38 (characterized)
to candidate BPHYT_RS21005 BPHYT_RS21005 asparaginase
Query= SwissProt::O68897 (362 letters) >lcl|FitnessBrowser__BFirm:BPHYT_RS21005 BPHYT_RS21005 asparaginase Length = 330 Score = 329 bits (844), Expect = 6e-95 Identities = 160/331 (48%), Positives = 233/331 (70%), Gaps = 2/331 (0%) Query: 32 TKLANVVILATGGTIAGAGASAANSATYQAAKVGIEQLIAGVPELSQIANVRGEQVMQIA 91 T AN+V++ TGGTIAG G ++ N++TY + +GI++++ +P ++AN+R EQ++Q Sbjct: 2 TAKANIVVIGTGGTIAGQGKASVNTSTYMCSVLGIDEILGSIPHAGELANLRAEQLLQTG 61 Query: 92 SESINNENLLQLGRRVAELADSKDVDGIVITHGTDTLEETAYFLNLVEKTDKPIIVVGSM 151 SE+ NN +LL +G RVAEL DVDG+VITHGTDT+EETAYFL+L K+ KP++VVGSM Sbjct: 62 SENFNNTHLLAIGNRVAELLARNDVDGVVITHGTDTIEETAYFLHLTLKSAKPVVVVGSM 121 Query: 152 RPGTAMSADGMLNLYNAVAVAGSKDARGKGVLVTMNDEIQSGRDVSKMINIKTEAFKSPW 211 RP +AMS+D LNLY+A+AVA +RG G LV N+EI + RDV K + K +AF+SP+ Sbjct: 122 RPPSAMSSDAALNLYDALAVATHPSSRGLGTLVVANNEIHTARDVVKSNSFKLDAFRSPY 181 Query: 212 GPLGMVVEGKSYWFRLPAKRHTMDSEFDIKTIKSLPDVEIAYGYGNVSDTAVKALAQAGA 271 G LG V+EG ++R PA+ HT+D+ + I T++SLP V+I Y YG + A+ A+ A A Sbjct: 182 GALGYVIEGAPRYYRRPARAHTLDTPWSITTLRSLPKVDIVYAYGALEPGAISAIT-ANA 240 Query: 272 KAIIHAGTGNGSVSSKVVPALQELRKQGVQIIRSSHVNAGGFVLRNAEQPDDKYDWVVAH 331 + +I+ GTGNG+V+S ++ L++ ++GV ++R+S + G VL N QPD +Y W+ Sbjct: 241 RGLIYVGTGNGNVASHLIDPLRDAARRGVHVVRASRTGS-GIVLHNGAQPDHEYGWLTVD 299 Query: 332 DLNPQKARILAMVALTKTQDSKELQRMFWEY 362 D PQKARIL +ALT+T D+ LQ +F Y Sbjct: 300 DQIPQKARILLTLALTQTDDTAALQAVFERY 330 Lambda K H 0.315 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 330 Length adjustment: 29 Effective length of query: 333 Effective length of database: 301 Effective search space: 100233 Effective search space used: 100233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS21005 BPHYT_RS21005 (asparaginase)
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.15356.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-108 347.5 0.1 4.3e-108 347.3 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS21005 BPHYT_RS21005 asparaginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS21005 BPHYT_RS21005 asparaginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 347.3 0.1 4.3e-108 4.3e-108 26 352 .] 6 330 .] 2 330 .] 0.97 Alignments for each domain: == domain 1 score: 347.3 bits; conditional E-value: 4.3e-108 TIGR00520 26 nikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqivnvgsqdlneevllklak 95 ni +++tGGtiag+g+ s +t+ Y +lg+++++ ++P+ e+an++ eq+ + gs+++n+++ll + + lcl|FitnessBrowser__BFirm:BPHYT_RS21005 6 NIVVIGTGGTIAGQGKASVNTSTYMCSVLGIDEILGSIPHAGELANLRAEQLLQTGSENFNNTHLLAIGN 75 899******************************************************************* PP TIGR00520 96 risealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpatsvsaDGplnLYnavsvaade 165 r+ e la +dvdG+vithGtDt+eetayfl lt+ks kPvv+vG+mRp +++s+D +lnLY+a++va+++ lcl|FitnessBrowser__BFirm:BPHYT_RS21005 76 RVAELLARNDVDGVVITHGTDTIEETAYFLHLTLKSAKPVVVVGSMRPPSAMSSDAALNLYDALAVATHP 145 ********************************************************************** PP TIGR00520 166 ksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandkieyerepvkkhtletefdvskld 235 s+g G+lvv n++i ar+v+k n+ +ld+f+s +GalGy+ ++ +y+r+p++ htl+t++++ l lcl|FitnessBrowser__BFirm:BPHYT_RS21005 146 SSRGLGTLVVANNEIHTARDVVKSNSFKLDAFRSP-YGALGYVIEGAPRYYRRPARAHTLDTPWSITTLR 214 **********************************9.********************************** PP TIGR00520 236 eplPkvdiiYayqnlpeelvkavvdagakGivlagvGnGslsaaalkvleeaakesvvivrssRvadGvv 305 + lPkvdi+Yay +l + + a++ + a+G++ g+GnG++ + + l +aa+++v +vr+sR+ +G+v lcl|FitnessBrowser__BFirm:BPHYT_RS21005 215 S-LPKVDIVYAYGALEPGAISAITAN-ARGLIYVGTGNGNVASHLIDPLRDAARRGVHVVRASRTGSGIV 282 *.*************99999988766.9****************************************** PP TIGR00520 306 tkdaevddk.ealiasgtLnPqkaRvLLqLaLtktkdlekiqevfeey 352 ++ + d+ ++ ++ + PqkaR+LL LaLt+t d+ +q+vfe y lcl|FitnessBrowser__BFirm:BPHYT_RS21005 283 LHNGAQPDHeYGWLTVDDQIPQKARILLTLALTQTDDTAALQAVFERY 330 99876655559**********************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (330 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.07 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory