Align Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; EC 3.5.1.38 (characterized)
to candidate BPHYT_RS21005 BPHYT_RS21005 asparaginase
Query= SwissProt::O68897 (362 letters) >FitnessBrowser__BFirm:BPHYT_RS21005 Length = 330 Score = 329 bits (844), Expect = 6e-95 Identities = 160/331 (48%), Positives = 233/331 (70%), Gaps = 2/331 (0%) Query: 32 TKLANVVILATGGTIAGAGASAANSATYQAAKVGIEQLIAGVPELSQIANVRGEQVMQIA 91 T AN+V++ TGGTIAG G ++ N++TY + +GI++++ +P ++AN+R EQ++Q Sbjct: 2 TAKANIVVIGTGGTIAGQGKASVNTSTYMCSVLGIDEILGSIPHAGELANLRAEQLLQTG 61 Query: 92 SESINNENLLQLGRRVAELADSKDVDGIVITHGTDTLEETAYFLNLVEKTDKPIIVVGSM 151 SE+ NN +LL +G RVAEL DVDG+VITHGTDT+EETAYFL+L K+ KP++VVGSM Sbjct: 62 SENFNNTHLLAIGNRVAELLARNDVDGVVITHGTDTIEETAYFLHLTLKSAKPVVVVGSM 121 Query: 152 RPGTAMSADGMLNLYNAVAVAGSKDARGKGVLVTMNDEIQSGRDVSKMINIKTEAFKSPW 211 RP +AMS+D LNLY+A+AVA +RG G LV N+EI + RDV K + K +AF+SP+ Sbjct: 122 RPPSAMSSDAALNLYDALAVATHPSSRGLGTLVVANNEIHTARDVVKSNSFKLDAFRSPY 181 Query: 212 GPLGMVVEGKSYWFRLPAKRHTMDSEFDIKTIKSLPDVEIAYGYGNVSDTAVKALAQAGA 271 G LG V+EG ++R PA+ HT+D+ + I T++SLP V+I Y YG + A+ A+ A A Sbjct: 182 GALGYVIEGAPRYYRRPARAHTLDTPWSITTLRSLPKVDIVYAYGALEPGAISAIT-ANA 240 Query: 272 KAIIHAGTGNGSVSSKVVPALQELRKQGVQIIRSSHVNAGGFVLRNAEQPDDKYDWVVAH 331 + +I+ GTGNG+V+S ++ L++ ++GV ++R+S + G VL N QPD +Y W+ Sbjct: 241 RGLIYVGTGNGNVASHLIDPLRDAARRGVHVVRASRTGS-GIVLHNGAQPDHEYGWLTVD 299 Query: 332 DLNPQKARILAMVALTKTQDSKELQRMFWEY 362 D PQKARIL +ALT+T D+ LQ +F Y Sbjct: 300 DQIPQKARILLTLALTQTDDTAALQAVFERY 330 Lambda K H 0.315 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 330 Length adjustment: 29 Effective length of query: 333 Effective length of database: 301 Effective search space: 100233 Effective search space used: 100233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS21005 BPHYT_RS21005 (asparaginase)
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.25704.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-108 347.5 0.1 4.3e-108 347.3 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS21005 BPHYT_RS21005 asparaginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS21005 BPHYT_RS21005 asparaginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 347.3 0.1 4.3e-108 4.3e-108 26 352 .] 6 330 .] 2 330 .] 0.97 Alignments for each domain: == domain 1 score: 347.3 bits; conditional E-value: 4.3e-108 TIGR00520 26 nikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqivnvgsqdlneevllklak 95 ni +++tGGtiag+g+ s +t+ Y +lg+++++ ++P+ e+an++ eq+ + gs+++n+++ll + + lcl|FitnessBrowser__BFirm:BPHYT_RS21005 6 NIVVIGTGGTIAGQGKASVNTSTYMCSVLGIDEILGSIPHAGELANLRAEQLLQTGSENFNNTHLLAIGN 75 899******************************************************************* PP TIGR00520 96 risealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpatsvsaDGplnLYnavsvaade 165 r+ e la +dvdG+vithGtDt+eetayfl lt+ks kPvv+vG+mRp +++s+D +lnLY+a++va+++ lcl|FitnessBrowser__BFirm:BPHYT_RS21005 76 RVAELLARNDVDGVVITHGTDTIEETAYFLHLTLKSAKPVVVVGSMRPPSAMSSDAALNLYDALAVATHP 145 ********************************************************************** PP TIGR00520 166 ksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandkieyerepvkkhtletefdvskld 235 s+g G+lvv n++i ar+v+k n+ +ld+f+s +GalGy+ ++ +y+r+p++ htl+t++++ l lcl|FitnessBrowser__BFirm:BPHYT_RS21005 146 SSRGLGTLVVANNEIHTARDVVKSNSFKLDAFRSP-YGALGYVIEGAPRYYRRPARAHTLDTPWSITTLR 214 **********************************9.********************************** PP TIGR00520 236 eplPkvdiiYayqnlpeelvkavvdagakGivlagvGnGslsaaalkvleeaakesvvivrssRvadGvv 305 + lPkvdi+Yay +l + + a++ + a+G++ g+GnG++ + + l +aa+++v +vr+sR+ +G+v lcl|FitnessBrowser__BFirm:BPHYT_RS21005 215 S-LPKVDIVYAYGALEPGAISAITAN-ARGLIYVGTGNGNVASHLIDPLRDAARRGVHVVRASRTGSGIV 282 *.*************99999988766.9****************************************** PP TIGR00520 306 tkdaevddk.ealiasgtLnPqkaRvLLqLaLtktkdlekiqevfeey 352 ++ + d+ ++ ++ + PqkaR+LL LaLt+t d+ +q+vfe y lcl|FitnessBrowser__BFirm:BPHYT_RS21005 283 LHNGAQPDHeYGWLTVDDQIPQKARILLTLALTQTDDTAALQAVFERY 330 99876655559**********************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (330 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.31 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory