Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate BPHYT_RS13290 BPHYT_RS13290 cysteine ABC transporter permease
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__BFirm:BPHYT_RS13290 Length = 225 Score = 95.9 bits (237), Expect = 9e-25 Identities = 46/128 (35%), Positives = 80/128 (62%) Query: 246 TALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQALRVIVPS 305 TA ++G GA+ +E+IRG I S+P GQWEAA ++G+TR Q L + ++PQA RV +P Sbjct: 90 TAAIIGFSLNVGAYNSEVIRGVIESIPKGQWEAAYSMGMTREQALRRAILPQAARVALPP 149 Query: 306 LNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFLILMLTYLAINAVISAGMN 365 L++ ++ K++SLA + P+++ AQ + T P+ ++ L YL ++V+S+ Sbjct: 150 LSNSFIALVKDTSLAAVLTVPEVFQAAQRIASVTYEPLILYTEAALVYLVFSSVLSSAQV 209 Query: 366 GLQQRLQR 373 L+++ R Sbjct: 210 RLERKFGR 217 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 225 Length adjustment: 26 Effective length of query: 351 Effective length of database: 199 Effective search space: 69849 Effective search space used: 69849 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory