Align ABC transporter for L-Asparagine and possibly other L-amino acids, periplasmic substrate-binding component (characterized)
to candidate BPHYT_RS14005 BPHYT_RS14005 ABC transporter
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4770 (304 letters) >FitnessBrowser__BFirm:BPHYT_RS14005 Length = 292 Score = 283 bits (724), Expect = 3e-81 Identities = 141/287 (49%), Positives = 191/287 (66%), Gaps = 2/287 (0%) Query: 14 AALISTPVFAAELTGTLKKIKESGTITLGHRDASIPFSYIADASGKPVGYSHDIQLKVVE 73 AA ++ ELTGTL+KI + G + LG R+ASIPFSY D G VGYS I L++VE Sbjct: 8 AASLACSAQTDELTGTLRKIHDDGVVVLGVREASIPFSYF-DGKGT-VGYSQTIALQIVE 65 Query: 74 ALKKDLDMPNLQVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQQVDFSVGIFEIGT 133 +KK L MP L+V VTS R P++ N +DLECGSTT+ VER+ FS F+ Sbjct: 66 EIKKTLGMPQLKVHEITVTSSNRTPMLLNNQIDLECGSTTHTVERENLAAFSNSFFQYAV 125 Query: 134 RLLSKADSKYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMGMNVISAKDHGESFQMLE 193 R++++ ++ DF DLAGK VVTTAGT+ ER+L+ +N DK + M + SA+DH E+F L+ Sbjct: 126 RMIARKNAGITDFQDLAGKAVVTTAGTSDERLLRRLNTDKLLNMRITSARDHSEAFNTLK 185 Query: 194 TGRAVAFMMDDALLAGEAAKAKKASDWAVTGTPQSYEIYGCMVRKGDEPFKKAVDDAIKA 253 GRAVAF+MD+ ++ G + + D+ VTGTP YE+Y CM RKGDEPF+ V+ I Sbjct: 186 DGRAVAFVMDEPIVYGFKSTDPRPDDFVVTGTPLGYEVYACMFRKGDEPFRTLVNGVIAR 245 Query: 254 TYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD 300 SGE ++Y +WF QPIPP G+NLNFP+S++ +AL A P D+A D Sbjct: 246 GQTSGEAERLYRQWFTQPIPPHGINLNFPLSEQNRALFAHPNDRALD 292 Lambda K H 0.315 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 292 Length adjustment: 26 Effective length of query: 278 Effective length of database: 266 Effective search space: 73948 Effective search space used: 73948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory