Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate BPHYT_RS34465 BPHYT_RS34465 glutamate/aspartate ABC transporter permease GltJ
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__BFirm:BPHYT_RS34465 Length = 245 Score = 90.1 bits (222), Expect = 6e-23 Identities = 46/128 (35%), Positives = 80/128 (62%) Query: 249 LLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQALRVIVPSLNS 308 + L YTG+ I E +R GI ++P GQ++A ALGLTR+QT +++P R I+ L S Sbjct: 115 IFSLGIYTGSRICEQVRAGIQALPRGQFDAGFALGLTRAQTYRYVLLPVTFRTILGPLTS 174 Query: 309 QYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFLILMLTYLAINAVISAGMNGLQ 368 +++ +KNS++A +G +L A+ ++ T +P E F+ + L Y+A+N I GMN ++ Sbjct: 175 EFLIISKNSAVASTIGLLELSGQARQLVDYTAQPYESFICVTLAYMALNFAILHGMNWIR 234 Query: 369 QRLQRWGV 376 ++ + G+ Sbjct: 235 RQTRLPGL 242 Score = 42.0 bits (97), Expect = 2e-08 Identities = 22/80 (27%), Positives = 37/80 (46%) Query: 77 SYARALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLL 136 +Y L GL+N++ + L V+GT G+ + L YV+V R PL++ Sbjct: 21 TYLGWLFSGLLNTVLLTVSAYALALVVGTGFGILRTLPSRPASMLGTAYVSVFRGVPLIV 80 Query: 137 QLIVWYFPILLSLPAAQQPW 156 Q +W+F + +P W Sbjct: 81 QFFIWFFVVPELVPTELGDW 100 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 245 Length adjustment: 27 Effective length of query: 350 Effective length of database: 218 Effective search space: 76300 Effective search space used: 76300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory