Align Amino acid:proton symporter (characterized, see rationale)
to candidate BPHYT_RS33330 BPHYT_RS33330 C4-dicarboxylate ABC transporter
Query= uniprot:A0A0N9WTL5 (431 letters) >FitnessBrowser__BFirm:BPHYT_RS33330 Length = 435 Score = 461 bits (1185), Expect = e-134 Identities = 238/423 (56%), Positives = 301/423 (71%), Gaps = 2/423 (0%) Query: 3 KNKLPRRIAMGIALGVLVGWACHHFAGSEQSAKEIASYFSMVTDIFLRMIKMIIAPLVFA 62 KN+L I G+ALGV+VG+ CH A AK IA YFS++TDIFLR++KMIIAPLVFA Sbjct: 2 KNRLTFYIVAGMALGVIVGYVCHRSAAGAAEAKTIAGYFSIITDIFLRLVKMIIAPLVFA 61 Query: 63 TLVGGIASMGNSRSVGRIGARAMAWFVTASVVSLLIGMGLVNLFQPGAGLNMDVAQHATA 122 TLV G+A M + V RIG R++ WFV AS+ SL +G+ L N QPGAGL+M + Sbjct: 62 TLVSGLAGMEGTSDVRRIGFRSVGWFVCASLFSLALGLALANALQPGAGLHMTQTS-SDV 120 Query: 123 AVPVNTGDFSLKAFIGHVFPRSIAEAMANNEILQIVVFSLFFGFALAGVKR-AGYTRITD 181 A +NT + K F+ H FP SI +AMA N+ILQI+VFS+ FG L+ +K+ T + Sbjct: 121 ATGLNTAGLNFKDFVTHAFPSSIIDAMARNDILQILVFSVLFGVVLSAIKKDPRVTPLIA 180 Query: 182 SIEELAKVMFKITDYVMAFAPIGVFAAIASAITTQGLGLLVDYGKLIAEFYLGILILWAL 241 I+ L M K+TDYVM APIGVF A+ASAIT GL +L YGKL+ FYLG++ LW + Sbjct: 181 GIDALVPAMLKLTDYVMRLAPIGVFGALASAITVNGLDVLTTYGKLVGSFYLGLVTLWIV 240 Query: 242 LFGAGYLFLGRSVFHLGKLIREPILLAFSTASSESAYPKTIEALEKFGAPKRVSSFVLPL 301 L GY FLG+S++ L K +REP +LAFSTASSE+AYP+ E LE FG K+V F LPL Sbjct: 241 LIFVGYAFLGKSIWRLLKAVREPAMLAFSTASSEAAYPRLTEKLEAFGIDKKVVGFTLPL 300 Query: 302 GYSFNLDGSMMYQAFAILFIAQAYNIDLSFTQQLLILLTLMITSKGMAGVARASVVVVAA 361 GY+FNLDGSMMYQAFA +FIAQA+ ID+ Q+++LL LM++SKGMAGVAR SVVVVAA Sbjct: 301 GYAFNLDGSMMYQAFAAIFIAQAFGIDMPLGAQIMMLLVLMLSSKGMAGVARGSVVVVAA 360 Query: 362 TLPMFNLPEAGLLLIIGIDQFLDMARTATNVVGNSIATAVVAKSESHEEADEEEGEHAPA 421 PMF+LP +G++LI+ IDQ LDM RTATNV+GNSIATAV+AK E+ +G +PA Sbjct: 361 IAPMFHLPPSGVVLILAIDQILDMGRTATNVIGNSIATAVIAKWEAKRAVKHIDGADSPA 420 Query: 422 RSR 424 R Sbjct: 421 LGR 423 Lambda K H 0.325 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 435 Length adjustment: 32 Effective length of query: 399 Effective length of database: 403 Effective search space: 160797 Effective search space used: 160797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory