Align Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale)
to candidate BPHYT_RS08555 BPHYT_RS08555 ABC transporter permease
Query= uniprot:Q31RN9 (396 letters) >FitnessBrowser__BFirm:BPHYT_RS08555 Length = 219 Score = 115 bits (289), Expect = 9e-31 Identities = 67/203 (33%), Positives = 120/203 (59%), Gaps = 6/203 (2%) Query: 190 GLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVM 249 G +LT+ A++SM+ L G +LAL S + W++ Y+ + RG PL+ +F Sbjct: 17 GAVLTVKFAVLSMIFGLIAGAVLALMGVSHNRVLNWIARIYVSVMRGTPLLVQIFVIYYG 76 Query: 250 VPLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLFQTYR 309 +P S +D ++ L+ ++AYL+E++RG + I GQ+ AA +LGL+ QT R Sbjct: 77 LPSFGIS---LDPTPAGVIALSANVAAYLSESMRGAILGIHNGQWLAAYSLGLSRRQTLR 133 Query: 310 FIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYAEVYLF 369 +++ PQALRI++P++ ++L++DT+L+S++ + ELL ++ I+A+ + +YL Sbjct: 134 YVIAPQALRIAVPSMSNSLISLIKDTSLVSVITVTELLRSAQEIIASTY---QPLPLYLA 190 Query: 370 LGVLYWLCCYGLAQLSRRLEQRL 392 +YW+ C L + R E+RL Sbjct: 191 AAAVYWVLCQVLESVQRWYERRL 213 Lambda K H 0.329 0.142 0.471 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 219 Length adjustment: 26 Effective length of query: 370 Effective length of database: 193 Effective search space: 71410 Effective search space used: 71410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory