Align ABC transporter for D-Cellobiose and D-Salicin, permease component 2 (characterized)
to candidate BPHYT_RS27975 BPHYT_RS27975 ABC transporter permease
Query= reanno::Smeli:SMc04258 (302 letters) >FitnessBrowser__BFirm:BPHYT_RS27975 Length = 318 Score = 110 bits (275), Expect = 4e-29 Identities = 83/288 (28%), Positives = 140/288 (48%), Gaps = 9/288 (3%) Query: 5 TRGSARPNQWLRNLNAKIAS----IPMILTAMVIFVGGTAWTVVYSFTNSKL-LPRLA-- 57 +R SAR L L+ + + +P +L + I + W + SFTN K +P + Sbjct: 14 SRASARARTRLAGLSDRTIAWLFILPTVLLLLAINIFPLIWALRLSFTNFKSNMPSVPAR 73 Query: 58 FVGFDQYERLWAAPRWLVSIQNLAVFGCLSLVFSLVIGFVLAALMDQKIRFENTFRTIML 117 FVG D Y + ++Q A F S+ +++GF LA L++++ R + + T++L Sbjct: 74 FVGIDNYVDILTDEDIWYAMQVTARFVFWSVGLEVLLGFGLALLINRQFRGHSFWTTLIL 133 Query: 118 YPFALSFIVTGLVWQWLLNPQYGIQSIVRSL--GWTSFSFDPLYNSNIVIYGILIAALWQ 175 P LS V G W +LL PQ G+ + + G SF + + ++ + I++ W Sbjct: 134 LPMMLSPAVVGNFWTFLLQPQTGLFNDIVGFFTGIAPGSFQMIGDVSLAPWTIVMVDTWM 193 Query: 176 GTGLVMCLMLAGLRGIDEDIWKAARVDGIPMWKTYVLIIIPMMRGVFITTLVIIASGIVK 235 T VM + LAGLR I + I++AA VD W+ + I +PM + ++ K Sbjct: 194 WTPYVMLICLAGLRSIPDYIYEAAEVDRATPWRQFWSITLPMTLPFLMLAVLFRGIENFK 253 Query: 236 VYDLVVAQTSGGPGIASEVPAKYVYDYMFQAQNLGQGFAASTMMLVTV 283 ++D+V TSGGPG +E + + F+ G A + ++ VTV Sbjct: 254 MFDMVNLLTSGGPGSVTETVSITLKRAAFEKWQTGYSSALAIILFVTV 301 Lambda K H 0.329 0.142 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 318 Length adjustment: 27 Effective length of query: 275 Effective length of database: 291 Effective search space: 80025 Effective search space used: 80025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory