Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate BPHYT_RS31200 BPHYT_RS31200 peptide ABC transporter substrate-binding protein
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__BFirm:BPHYT_RS31200 Length = 325 Score = 195 bits (496), Expect = 1e-54 Identities = 112/310 (36%), Positives = 181/310 (58%), Gaps = 11/310 (3%) Query: 6 LKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTL 65 L +N+R ++ KAVD SF++ E++G+VGESG GK+ + + P + Sbjct: 6 LSVQNLRTHFFTGAGVAKAVDDTSFDVAPGEIVGLVGESGSGKSITGFSVLGLIDAPGRI 65 Query: 66 VDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAES 125 V G++ + GE +L+++T E R+ G I +I Q M L P +R++ + ++ Sbjct: 66 VAGRVLFK--GE--DLTTLT-PEALRRLRGNRIAMIFQDPMMTLNPVLRIDTQMIEAVQA 120 Query: 126 HG-IDEEELLDKARRRFEEVGLDPL--WIKRYPFELSGGMRQRAVIAIATILNPSLLIAD 182 H + + +AR VG+ ++ YP +LSGGMRQR IAIA + +P L+IAD Sbjct: 121 HTRVSKHAARQRARDALASVGIPSPDERLRAYPHQLSGGMRQRVAIAIALLHDPELIIAD 180 Query: 183 EPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAP 242 EPT+ALDV Q +L + ++ + ++++++HD+A V +ADR+ +MYAG++VE Sbjct: 181 EPTTALDVTIQAQILAEMQKLCARSHT-AMVWVSHDLAVVAGLADRICVMYAGRVVETGS 239 Query: 243 VESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMD 302 V+ +LE+P HPYT GL +S+ PE + +T IPG P+ + P GC F PRC +A Sbjct: 240 VDEILERPRHPYTIGLIDSL--PEKARRGESLTQIPGMAPSALKLPVGCAFAPRCVYATS 297 Query: 303 VCKEKEPPLT 312 +C+ EPP+T Sbjct: 298 LCRSAEPPVT 307 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 325 Length adjustment: 28 Effective length of query: 302 Effective length of database: 297 Effective search space: 89694 Effective search space used: 89694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory