Align TM0030, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate BPHYT_RS31190 BPHYT_RS31190 ABC transporter permease
Query= TCDB::Q9WXN7 (338 letters) >FitnessBrowser__BFirm:BPHYT_RS31190 Length = 323 Score = 177 bits (449), Expect = 3e-49 Identities = 110/331 (33%), Positives = 183/331 (55%), Gaps = 13/331 (3%) Query: 6 MFKYLLRRFIFLLVTYIVATTIVFILPRAIPGNPLSQILSGLSRVAQANPEAIRAAERTL 65 M +++RR I + ++ + +VF AI G+P++ ++ A A P I A ++L Sbjct: 1 MIAFIIRRLIQSIGVLLLTSVLVFCGVFAI-GDPIAILVP-----ADATPAEIAQAVQSL 54 Query: 66 MEEFGLGKPWYVQYFEFITKALRGDLGTSITFYPRKVIDLIIPVIPWTLILLLPATIVAW 125 GL +P + QY FI +AL GDLG S F + I LI+ +P TL L A ++A Sbjct: 55 ----GLDRPLWQQYLHFIGRALHGDLGRSFVFN-QPSIPLILERLPATLELACVALVLAL 109 Query: 126 ILGNSLGALAAYKRNTWIDKGVLTTSLIVSQIPYYWLGMIFIFLFGVKLGWLPVQGAYSQ 185 I+G LG +A K + +D+ V+T S++ +P +W G++ + +F V LGWLP G Sbjct: 110 IVGLPLGLIAGLKAGSVLDRTVMTGSILGFSLPNFWQGIMLVLIFSVTLGWLPSAGRGQP 169 Query: 186 GTIPNLSWSFFV-DVLKHYIMPFASIVVSAMGGWAIGMRLMVIYELGSDYAMFSEYLGMK 244 G + + S D L+H ++P ++ + M R V L DY F+ G++ Sbjct: 170 GILFGIHTSLATWDGLRHLLLPALNLSLFKMSLVTRLTRAGVRETLPLDYVKFARAKGLR 229 Query: 245 DKR-IFKYVFRNSLLPQITGLALSLGGVLGGALITEIVFNYPGTGYLLFRALTTLDYPLI 303 ++R IF +V +N L+P +T + + G ++ A +TE +F +PG G L+ ++T LD P+I Sbjct: 230 ERRVIFVHVLKNILIPIVTVVGMEFGSLIAFATVTETIFAWPGVGKLIIDSITKLDRPVI 289 Query: 304 QGIFVILIASIYLANFIVDFLYALIDPRIRL 334 +I++A L N +VD +Y+L+DPR+RL Sbjct: 290 VAYLLIVVAMFTLLNLLVDIIYSLLDPRVRL 320 Lambda K H 0.329 0.146 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 323 Length adjustment: 28 Effective length of query: 310 Effective length of database: 295 Effective search space: 91450 Effective search space used: 91450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory