Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate BPHYT_RS35660 BPHYT_RS35660 membrane protein
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__BFirm:BPHYT_RS35660 Length = 283 Score = 157 bits (398), Expect = 2e-43 Identities = 88/284 (30%), Positives = 163/284 (57%), Gaps = 8/284 (2%) Query: 9 SMKRKKKIKDTIANIILAILVVLTLGPIVFMVLTSLMDHNAIA--RGKWI-APTRFSNYV 65 S+K K+ + +A L+ LVV+ L P M+ T+L + I +W+ ++SN+ Sbjct: 4 SVKMKRSLWCWLA---LSPLVVVVLFPFAVMLFTALKPASEIFVYPARWLPVHWQWSNFS 60 Query: 66 EVFQKLPFGIYFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPG 125 +++ FG+ RNS ++ + +AL ++ A Y+LA++ F G G + +L TQ+L Sbjct: 61 DMWVAANFGVALRNSTVISLLSTALALAVSLPAAYALARFPFRGRGLYRQFLLVTQMLSP 120 Query: 126 MMFLLPLYLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAA 185 ++ ++ L+ I G L++S G+++ Y+AF + F++W++ +F ++P +LEE+A Sbjct: 121 ILLVVGLFRLAAMIPYGDG-NLVDSKIGVIVSYAAFNIAFAVWMLSSYFQTVPRDLEESA 179 Query: 186 RIDGCNKFTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGF 245 ++GC + A +V LPLAVP IV TAI+ F+ AW+E + L++ + T+ + Sbjct: 180 WLEGCGRTKAVFKVFLPLAVPAIVVTAIFTFINAWNEFAVVYTLIRSPENKTLTVQVTDM 239 Query: 246 IA-YTTARYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVK 288 +A ++ L+MAA T+PV ++F +Q+ + G+ GAVK Sbjct: 240 VAGKYVVQWHLVMAATLCATLPVSVVFAWLQRYLVKGLALGAVK 283 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 283 Length adjustment: 26 Effective length of query: 263 Effective length of database: 257 Effective search space: 67591 Effective search space used: 67591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory