Align Fe(3+) dicitrate-binding periplasmic protein; Iron(III) dicitrate-binding periplasmic protein (characterized)
to candidate BPHYT_RS20245 BPHYT_RS20245 iron ABC transporter substrate-binding protein
Query= SwissProt::P15028 (300 letters) >FitnessBrowser__BFirm:BPHYT_RS20245 Length = 366 Score = 97.8 bits (242), Expect = 3e-25 Identities = 82/270 (30%), Positives = 130/270 (48%), Gaps = 18/270 (6%) Query: 32 TLEKTPQRIVVLELSFADALAAVDVIPIGIADDNDAKRILPEVRAHLKPWQSVGTRAQPS 91 +L P+RIVVLE FA+ LAAV + P+G+AD + A L +GTR +PS Sbjct: 78 SLPAQPKRIVVLEFMFAEDLAAVGITPVGMADPEYYPVWIGYDNARLASVPDIGTRQEPS 137 Query: 92 LEAIAALKPDLIIADSSRHAGVYIALQQIAPVLLLKSRNETYAENLQSAAI--------- 142 LEAIAA KPDLI+ RHA ++ AL++IAP +L K + + + Sbjct: 138 LEAIAAAKPDLILGVGLRHAPIFAALERIAPTVLFKYGPNFTEDGARVTQLDWGRKILRT 197 Query: 143 IGEMVGKK---REMQARLEQHKERMAQWASQL-PKGTRVAF--GTSREQQFNLHTQETWT 196 IG + G++ R ++A+++ R AQ ++ +G +VA+ ++ T + Sbjct: 198 IGCLTGREEAARAVEAKVDAGFARDAQRLAEAGRRGEQVAWLQELGLPDRYWAFTGNSTA 257 Query: 197 GSVLASLGLNV-PAAMAGASMPSIGLEQLLAVNPAWLLVAHYREESIVKRWQQD-PLWQM 254 V +LGLN+ PA + E LL +L E+ + + D P+W+ Sbjct: 258 AGVAHALGLNLWPAEATREGTAYVSSEDLLKKPKLTVLFVSATEKDVPLATKLDSPIWRF 317 Query: 255 LTAAQKQQVASVDSNTWARMRGIFAAERIA 284 + A +V V+ N W G +A R+A Sbjct: 318 VPARSAGRVGLVERNIWG-FGGPMSALRLA 346 Lambda K H 0.320 0.131 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 366 Length adjustment: 28 Effective length of query: 272 Effective length of database: 338 Effective search space: 91936 Effective search space used: 91936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory