Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate BPHYT_RS04860 BPHYT_RS04860 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__BFirm:BPHYT_RS04860 Length = 280 Score = 126 bits (317), Expect = 4e-34 Identities = 80/235 (34%), Positives = 121/235 (51%), Gaps = 1/235 (0%) Query: 2 TLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFL 61 TL + LT+ G +L+ + + G+I + GPNG GK+TLL+ + LL P +G V L Sbjct: 12 TLGAQRLTLRAGARTLLDAFTHTFYAGEIWCIAGPNGAGKTTLLSTLAGLLQPSAGHVEL 71 Query: 62 GDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNV 121 + LA+R +L+PQ +V ++V R P L+ WG D + Sbjct: 72 DGVRLADWPPLSLAQRRALMPQSAPDAFSASVLDIVMLNRFPHLTGWGWEREADREAAHA 131 Query: 122 AMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVD-LMRL 180 A++ + A R + LSGG+RQR LA VL Q+ P++LLDEP +LD++HQ+D L L Sbjct: 132 ALDLLGLAAFAARDVLSLSGGERQRVALAAVLCQDAPLLLLDEPLAHLDLHHQIDCLEAL 191 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVF 235 R +TV+ HDLN A R+ +++ G +V+TP L F Sbjct: 192 AAWTRAPRRTVMFSCHDLNFARRFATHALLLDGAGGAYAGPVHDVLTPTLASRAF 246 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 280 Length adjustment: 25 Effective length of query: 230 Effective length of database: 255 Effective search space: 58650 Effective search space used: 58650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory