Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate BPHYT_RS28185 BPHYT_RS28185 lipase
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__BFirm:BPHYT_RS28185 Length = 355 Score = 119 bits (297), Expect = 1e-31 Identities = 80/241 (33%), Positives = 125/241 (51%), Gaps = 11/241 (4%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L+ +NL +SYG + +L VS L G++ L+G +G GK+TLL + L P +G + L Sbjct: 4 LKVDNLFLSYGDNPILKGVSFELNPGEVVCLLGASGSGKTTLLRAVAGLEQPSAGRIELD 63 Query: 63 DNPINMLSSRQ----LARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNAR 118 ++R R L L+ Q + TV E V YG L L + E R Sbjct: 64 GKAFFDGATRVDLPVEQRSLGLVFQSYALWPHRTVAENVGYG----LKLRRVSTVEQKKR 119 Query: 119 VNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLM 178 V A++Q + HLA R +LSGGQ+QR +A L N PV+LLDEP + LD + + Sbjct: 120 VQAALDQLGLGHLAARYPYQLSGGQQQRVAIARALVYNPPVILLDEPLSNLDAKLREEAR 179 Query: 179 RLMGELRTQ-GKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSV 237 + EL G + + V HD +A D+++++ NG + +GTP ++ G R++++ Sbjct: 180 AWLRELIVSLGLSALCVTHDQTEAMAMSDRILLLRNGRIEQEGTPADLY--GAPRSLYTA 237 Query: 238 E 238 E Sbjct: 238 E 238 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 355 Length adjustment: 27 Effective length of query: 228 Effective length of database: 328 Effective search space: 74784 Effective search space used: 74784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory