Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate BPHYT_RS24035 BPHYT_RS24035 ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__BFirm:BPHYT_RS24035 Length = 289 Score = 254 bits (648), Expect = 2e-72 Identities = 129/246 (52%), Positives = 176/246 (71%), Gaps = 1/246 (0%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 +EV+DL KR+G EVL+GV L+ A +V+ IIG SGSGKST LRC+ LE G + + Sbjct: 25 IEVRDLRKRFGEVEVLRGVDLEIARSEVVCIIGPSGSGKSTLLRCLAALETYDQGDVRIE 84 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 E L + ++G A ++ R+R + MVFQ FNLW HMTA+ N+ME+ + V +S+ Sbjct: 85 GELLGY-SERNGKRVRASQSEINRVRRNVGMVFQQFNLWPHMTALGNVMESLLRVRHLSR 143 Query: 124 AEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 EAR +A L VG++H+ DAYP +SGG+QQRVAIARALAMEP +MLFDEPTSALDPE Sbjct: 144 DEARRRANAMLETVGLAHKGDAYPAKLSGGQQQRVAIARALAMEPHIMLFDEPTSALDPE 203 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 LVG+VL+VM+ LA++G TM VVTHEMGFA +V+++++F+ +G + G PR+V + Sbjct: 204 LVGEVLQVMKQLARDGMTMAVVTHEMGFAAQVADKVMFIDQGRIAVQGKPRDVFHDAGQP 263 Query: 244 RLQQFL 249 RL+QFL Sbjct: 264 RLRQFL 269 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 289 Length adjustment: 25 Effective length of query: 229 Effective length of database: 264 Effective search space: 60456 Effective search space used: 60456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory