Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate BPHYT_RS35100 BPHYT_RS35100 ABC transporter substrate-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3431 (257 letters) >FitnessBrowser__BFirm:BPHYT_RS35100 Length = 263 Score = 220 bits (561), Expect = 2e-62 Identities = 123/262 (46%), Positives = 170/262 (64%), Gaps = 13/262 (4%) Query: 4 LVLLGALALSVLSLP------TFADEKP-LKIGIEAAYPPFASKAPDGSIVGFDYDIGNA 56 L +LGA + LS FA E L++GI+ +YPP +KAPDGS GFD D+GN Sbjct: 5 LTILGAALSTALSAALAFSTSAFAVEPTTLRLGIDPSYPPMDAKAPDGSFKGFDVDLGNE 64 Query: 57 LCEEMKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPARLVM 116 +C+ + +C WVE EF G+IPAL+ RKIDAILSSM+ITE R++ + F++K + +RL+ Sbjct: 65 ICKRIHARCQWVELEFSGMIPALQARKIDAILSSMAITEKREQQILFSSKLFQFKSRLIA 124 Query: 117 KAGTAVSENLAELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLD 176 + G+A++ L GK IGVQ G+ E +A + APLGA + Y SQ+E++ D+ GRLD Sbjct: 125 RQGSALAGGTNALAGKQIGVQSGTQFEGYALKNWAPLGAHVVAYKSQDEVFADLQNGRLD 184 Query: 177 GTVADATLLDDGFLKTDAGKGFAFVGPAFTDVKYFGD-GVGIAVRKGD-ALKDKINTAIA 234 G + + D GFL+T AGKGFAFVG + GD GVGI +RK + A++ IN AIA Sbjct: 185 GALLGSVEADIGFLRTPAGKGFAFVGEPLS----MGDRGVGIGLRKDETAVQASINAAIA 240 Query: 235 AIRENGKYKQIQDKYFAFDIYG 256 ++ ++G Y QI KYF FD YG Sbjct: 241 SMLKDGTYAQIAKKYFDFDPYG 262 Lambda K H 0.318 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory