GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Burkholderia phytofirmans PsJN

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate BPHYT_RS03490 BPHYT_RS03490 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS03490 BPHYT_RS03490
           pyrroline-5-carboxylate reductase
          Length = 271

 Score =  223 bits (567), Expect = 4e-63
 Identities = 121/269 (44%), Positives = 165/269 (61%)

Query: 5   RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64
           +IAFIG GNMAA+LIGGL  +GV  A + A DP  +   +   +F I    +    +A  
Sbjct: 2   KIAFIGGGNMAAALIGGLIKRGVAPADLYAIDPNEDALKRNEQQFGIKTGAAADAGLAAY 61

Query: 65  DVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTPA 124
           D VVL+VKPQ +K+V +A+AP L   QL VSI AGI    +  WL     +VR MPNTPA
Sbjct: 62  DAVVLAVKPQILKSVAEAVAPHLNASQLAVSIVAGIRMGDMSRWLNGHDRIVRVMPNTPA 121

Query: 125 LLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLLM 184
           L+  G +GL A + V  A    A Q+L AVG  +W DDEA+IDAVTA+SGSGPAY F  +
Sbjct: 122 LIGMGVTGLVATSSVDEAGRALASQVLGAVGETVWFDDEAKIDAVTAISGSGPAYVFYFI 181

Query: 185 QAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKSF 244
           +A+ +A  +LG+       L + T  GAAQ+A +S+  P+ LR RVTS  GTT AA+ SF
Sbjct: 182 EALQEAARQLGMDESQGRALAVATFTGAAQLAANSDEPPSVLRERVTSKGGTTAAALASF 241

Query: 245 QANGFEALVEQALNAASQRSAELAEQLGQ 273
            A+G +  + +   AA  R+ E+ ++ G+
Sbjct: 242 DASGIKDAIVRGALAADARAKEMGDEFGK 270


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 185
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 271
Length adjustment: 25
Effective length of query: 248
Effective length of database: 246
Effective search space:    61008
Effective search space used:    61008
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate BPHYT_RS03490 BPHYT_RS03490 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.21400.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
    2.9e-79  252.4   5.5    3.3e-79  252.2   5.5    1.0  1  lcl|FitnessBrowser__BFirm:BPHYT_RS03490  BPHYT_RS03490 pyrroline-5-carbox


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS03490  BPHYT_RS03490 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  252.2   5.5   3.3e-79   3.3e-79       1     263 []       3     264 ..       3     264 .. 0.98

  Alignments for each domain:
  == domain 1  score: 252.2 bits;  conditional E-value: 3.3e-79
                                TIGR00112   1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPq 70 
                                              ia+iG+Gnm++al+ gl+k+g++ +++++ i+++e++l+++ +++g+++ ++a++  ++ d v+lavKPq
  lcl|FitnessBrowser__BFirm:BPHYT_RS03490   3 IAFIGGGNMAAALIGGLIKRGVA-PADLYAIDPNEDALKRNEQQFGIKTGAAADAGLAAYDAVVLAVKPQ 71 
                                              89*****************9887.9********************************************* PP

                                TIGR00112  71 dleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeq 140
                                               l++v++ ++  + ++++l +Si+AG+++ +++++l+++ r+vRvmPNt+a +g gvt+++a+s v+e+ 
  lcl|FitnessBrowser__BFirm:BPHYT_RS03490  72 ILKSVAEAVAP-HLNASQLAVSIVAGIRMGDMSRWLNGHDRIVRVMPNTPALIGMGVTGLVATSSVDEAG 140
                                              *******9998.77799***************************************************** PP

                                TIGR00112 141 kelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaa 209
                                              ++l++++l avG++v+ + e+++davta+sGSgPA+vf++ieal++a+ +lG+++++ ++la +t+ Gaa
  lcl|FitnessBrowser__BFirm:BPHYT_RS03490 141 RALASQVLGAVGETVWFDdEAKIDAVTAISGSGPAYVFYFIEALQEAARQLGMDESQGRALAVATFTGAA 210
                                              ********************************************************************** PP

                                TIGR00112 210 klleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263
                                              +l ++s+e p++L+++Vts+gGtT+a+la++ ++g+++a+ ++  aa +r++e+
  lcl|FitnessBrowser__BFirm:BPHYT_RS03490 211 QLAANSDEPPSVLRERVTSKGGTTAAALASFDASGIKDAIVRGALAADARAKEM 264
                                              **************************************************9986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (271 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.68
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory