Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS00160 BPHYT_RS00160 ABC transporter substrate-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__BFirm:BPHYT_RS00160 Length = 262 Score = 216 bits (551), Expect = 3e-61 Identities = 120/257 (46%), Positives = 153/257 (59%), Gaps = 3/257 (1%) Query: 1 MTPLRSLFAALLLPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICA 60 + PL +L A L A++ A +RFG+ +YPPFES +G LQG DI++GNA+C Sbjct: 4 LKPLLAL-ACAFASLAASSGASAADTLRFGLEAQYPPFESKGPNGELQGLDIDVGNAVCV 62 Query: 61 KLEVKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKS 120 + C WV FDG+IPAL+ RKFDAI S+M T AR + IDF+ ++ PT +I ++ Sbjct: 63 AAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATDARRQAIDFTTVVYRVPTQLIAKRD 122 Query: 121 ADFGDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATL 180 + TP SL GK+VGVLQ S+QE YA+AH G + YQ Q+Q Y DL GRLDATL Sbjct: 123 SGLLPTPASLKGKRVGVLQASIQETYAKAHWESAGVTVVPYQDQNQVYTDLVAGRLDATL 182 Query: 181 TDKLEAQLNFLSKP--EGSDFKTGPAFKDPTLPLDIAMGLRKNDQALRALINKGIAAVQA 238 Q FLSKP EG F P D L IA G+RK D ALR +N IA VQA Sbjct: 183 VLAPAGQTGFLSKPSGEGYAFVGEPVRDDKILGSGIAYGIRKGDTALRDRLNAAIAKVQA 242 Query: 239 DGTYAQIQKKYFGDQDI 255 DGT + KY G+ D+ Sbjct: 243 DGTVKTLAAKYLGNIDV 259 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory