Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS10140 BPHYT_RS10140 ABC transporter substrate-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__BFirm:BPHYT_RS10140 Length = 260 Score = 248 bits (632), Expect = 1e-70 Identities = 132/255 (51%), Positives = 169/255 (66%), Gaps = 3/255 (1%) Query: 4 LRSLFAALLLPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLE 63 L SL ALL A A+EW +RFGV YPPFES +ADG L GFDI+LGN IC +L Sbjct: 5 LASLSIALLAISSGNAIAKEWSTVRFGVDASYPPFESKSADGKLVGFDIDLGNEICRRLN 64 Query: 64 VKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADF 123 KC WV N FDGMIPAL+ RKFD ++S+M++TPAR+ I FS ++F PT ++ +K + Sbjct: 65 AKCVWVENAFDGMIPALKGRKFDGVLSTMSMTPARQAQIAFSSKVFRIPTRLVAKKGSTI 124 Query: 124 GDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDK 183 TPE+L GK++GV QGS+QE YA+ + GA I AYQ QD Y+DL GR+DA+L + Sbjct: 125 TPTPEALKGKRIGVEQGSIQETYAKTYWEPAGAVIVAYQDQDLVYSDLLAGRIDASLQNA 184 Query: 184 LEAQLNFLSKPEGSDFK-TGPAFKD-PTLPLDIAMGLRKNDQALRALINKGIAAVQADGT 241 ++A + FL P G DF G A D TL A+GLRK D L+A I+K IA +ADGT Sbjct: 185 VQADVGFLRTPRGKDFAFAGNALYDAKTLGSGTAIGLRKEDTDLKAQIDKAIADTRADGT 244 Query: 242 YAQIQKKYFGDQDIY 256 Y +I KKYF D D+Y Sbjct: 245 YDRIAKKYF-DFDVY 258 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory