GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davD in Burkholderia phytofirmans PsJN

Align Glutarate-semialdehyde dehydrogenase; EC 1.2.1.- (characterized)
to candidate BPHYT_RS30285 BPHYT_RS30285 succinate-semialdehyde dehydrogenase

Query= SwissProt::Q9I6M5
         (483 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS30285 BPHYT_RS30285
           succinate-semialdehyde dehydrogenase
          Length = 490

 Score =  542 bits (1397), Expect = e-159
 Identities = 268/481 (55%), Positives = 343/481 (71%), Gaps = 4/481 (0%)

Query: 7   KLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKMGAAETRRAIEAADKALPAWRA 66
           +L R Q  +DGAW  A +G    V NPATGE I  V   GAA+ R A +AA +A PAWR 
Sbjct: 9   ELIRPQNLIDGAWTGAADGARFAVTNPATGETIVEVADSGAADARAATDAAARAFPAWRD 68

Query: 67  LTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAEAKGEIAYAASFLEWFGEEAKRI 126
              +ERA  LRRW  L++ N DDLA+LM++EQGKPLAEA+GE+AY AS++ WF +EA RI
Sbjct: 69  TLPRERAEILRRWHALIVANTDDLAKLMSMEQGKPLAEARGEVAYGASYVAWFADEATRI 128

Query: 127 YGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLKPASQTP 186
           YGD IP  Q  KR+  +K+P+GV AAITPWNFP AMI RK  PALAAGCT+V KPA  TP
Sbjct: 129 YGDLIPQQQRGKRMSAVKEPVGVIAAITPWNFPLAMIARKIAPALAAGCTVVAKPAEDTP 188

Query: 187 YSALALAELAERAGIPKGVFSVVTGSAGE---VGGELTSNPIVRKLTFTGSTEIGRQLMA 243
            +ALALA LA+ AG+P GV ++++ S  +      +  ++  VRK+TFTGST +G+ L  
Sbjct: 189 LTALALAVLAQEAGLPDGVLNMLSASREQGIAAVADWLADSRVRKITFTGSTPVGKHLAR 248

Query: 244 ECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISKYRNNGQTCVCANRLYVQDGVYD 303
           E A  +KK+SLELGGNAPFIVFDDADLDAAV G + +K+RN GQTCVC NR+YVQ GVY+
Sbjct: 249 ESAGTLKKLSLELGGNAPFIVFDDADLDAAVTGLMAAKFRNGGQTCVCPNRVYVQAGVYE 308

Query: 304 AFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVAKVEEHIADAVSKGAKVVSGGKP-HA 362
            F D L   V  L +    +     GP+I+ +A+ K+  H+ DAV  GAKV+ GGK    
Sbjct: 309 RFADLLAKRVGALKVAPATDPQAQIGPMINERAIQKIARHVEDAVKHGAKVLVGGKRLTE 368

Query: 363 LGGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKDEAEVIAMSNDTEFGLASYFYARD 422
           LG  ++ PT+L D   + LVS +ETFGP+AP+FRF +EAE I +SNDT FGLA+YFY +D
Sbjct: 369 LGPNYYAPTVLTDARDDMLVSCEETFGPVAPLFRFNEEAEAIRLSNDTPFGLAAYFYTQD 428

Query: 423 LARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCLGG 482
           + R+ RVA QLE G++GIN G +S+E APFGG+K SG GREGSKYG++DY+ IKY+C GG
Sbjct: 429 VRRINRVAAQLEAGVIGINEGAVSSEAAPFGGVKESGYGREGSKYGLDDYMSIKYMCQGG 488

Query: 483 I 483
           +
Sbjct: 489 L 489


Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 665
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 490
Length adjustment: 34
Effective length of query: 449
Effective length of database: 456
Effective search space:   204744
Effective search space used:   204744
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory