Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate BPHYT_RS27170 BPHYT_RS27170 hypothetical protein
Query= reanno::SB2B:6938540 (460 letters) >FitnessBrowser__BFirm:BPHYT_RS27170 Length = 442 Score = 265 bits (677), Expect = 2e-75 Identities = 156/439 (35%), Positives = 248/439 (56%), Gaps = 17/439 (3%) Query: 30 LAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRKSIADAAYAQLQTLPF-YN 88 L K+ V +G+ I D+ G + +DA G +G+ + + DA Q Q LP+ + Sbjct: 8 LPKQSLPVAVAGDGIEIIDSTGKRYIDASGGAAVSCLGHSNQRVIDAIKRQAQQLPYAHT 67 Query: 89 NFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNLRMVRRYWDLKGMPSKKTI 148 +FF T PA LA ++ + AP + V+F GSEA + L++ R+Y+ KG P ++ Sbjct: 68 SFF--TTAPAEELADRLVASAPQGLEHVYFVSGGSEAIEAALKLARQYFVEKGEPQRRHF 125 Query: 149 ISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHIDQP-YWFGEGR-DMSPEAFGIKT 206 I+R+ +YHG+T+ ++GG + ++ LPI H P Y + E R D + EAF + Sbjct: 126 IARRQSYHGNTLGALAIGGNAW-RREPFLPILIEAHHVSPCYAYREQRADETEEAFAQRL 184 Query: 207 AQALEAKILELGEDKVAAFIAEPFQGAGGVIIPP-DSYWNEIKRILEKYNILFILDEVIS 265 A LE KILELG D VAAF+AE GA +PP Y+ +I+ + ++Y +L ILDE++S Sbjct: 185 ADELEQKILELGADTVAAFVAETVVGATAGAVPPVREYFRKIRAVCDRYGVLLILDEIMS 244 Query: 266 GFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVADVLISDGGEFAHGFTY 325 G GRTG+ +A + G+ PD++TIAKG+ +GY P+G +VSDR+ ++ G F HG TY Sbjct: 245 GMGRTGHLYACEEDGVAPDILTIAKGLGAGYQPIGATLVSDRIYQAIVGGSGFFQHGHTY 304 Query: 326 SGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRL-QTLSAHPLVGEVRGMGMVGAI 384 GH A A ALE R++EE++L+ V G L+ +L + + HP +G+VRG G+ + Sbjct: 305 IGHATACAAALEVQRVIEEDKLLPNVLA-RGEQLRGQLREHYAQHPHIGDVRGRGLFVGV 363 Query: 385 ELVADKHSMVRFGSEISAGMLCREACIESGLVM--------RAVGDTMIISPPLCITRDE 436 ELV D+ F + + + R GL++ +GD ++++PP T + Sbjct: 364 ELVRDRAGKTPFDARLKLHAVIRREAFARGLMVYPMGGTVDGQIGDHVLLAPPFICTERD 423 Query: 437 IDELIFKASQALSLTLEKI 455 IDE++ + + A+ L I Sbjct: 424 IDEIVSRFTDAVGGALAAI 442 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 442 Length adjustment: 33 Effective length of query: 427 Effective length of database: 409 Effective search space: 174643 Effective search space used: 174643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory