Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate BPHYT_RS20325 BPHYT_RS20325 acyl-CoA dehydrogenase
Query= BRENDA::Q92947 (438 letters) >FitnessBrowser__BFirm:BPHYT_RS20325 Length = 388 Score = 168 bits (426), Expect = 2e-46 Identities = 119/364 (32%), Positives = 180/364 (49%), Gaps = 16/364 (4%) Query: 74 YCQERLMPRILLANRNEVFHREIISEMGELGVLGPTI-KGYGCAGVSSVAYGLLARELER 132 + ++ +PR + + +++ M ELG G +I + +G AG+S+ A EL + Sbjct: 8 FVRDEAIPRENEIEQADAVPADLVQRMRELGYFGWSIPRDFGGAGLSTEQLVRGAFELSQ 67 Query: 133 VDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSME 192 +R+ + + + + A G++ Q+Q+YLP+LA GE G F LTEP++GSD +++ Sbjct: 68 ASVAFRARVGTNTGIGSEALVADGTDTQKQRYLPRLASGEFTGAFALTEPDAGSDATALR 127 Query: 193 TRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCE-----DGCIRGFLLEKGMRGLSA 247 T A + + Y L+G+K +ITN+P+ADLF V AR E G I FL+E+G GLS Sbjct: 128 TTARRDGDH--YILDGSKCFITNAPIADLFTVMARTELAKPGAGGISAFLVERGTPGLST 185 Query: 248 PRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLG--GPFGCLNNARYGIAWGVLGAS 305 K S G ++ +G VP N++ G +G LN R +A G + Sbjct: 186 SAPYDKMGQAGSPVGDVVFEGCRVPAANLIGGKEGMGFRTAMKVLNKQRIHLAALCTGPA 245 Query: 306 EFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKD--QDKA- 362 L A Y R QFG P+A QL+Q +A+ TEI L+ R +D +D A Sbjct: 246 MRMLEEAVAYTSRREQFGKPVAEFQLVQALIAECQTEIYAARSMILETARKRDAGEDVAL 305 Query: 363 APEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHAL 422 M + CG+ D A Q MLGG G V R ++ A YEGT IH L Sbjct: 306 EASMCKMFASEMCGRVADRAVQ---MLGGRGYLAGNAVERFYRDVRAFRIYEGTTQIHQL 362 Query: 423 ILGR 426 + + Sbjct: 363 NIAK 366 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 388 Length adjustment: 31 Effective length of query: 407 Effective length of database: 357 Effective search space: 145299 Effective search space used: 145299 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory