Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate BPHYT_RS23120 BPHYT_RS23120 FAD-dependent oxidoreductase
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >FitnessBrowser__BFirm:BPHYT_RS23120 Length = 423 Score = 326 bits (836), Expect = 7e-94 Identities = 175/414 (42%), Positives = 250/414 (60%), Gaps = 4/414 (0%) Query: 9 SYYAASA-NPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGA 67 SYY ASA P+ PAL +E DVCVIGAG++GLS AL G V VL+A + G+GA Sbjct: 5 SYYEASAARPLADDPALDGTLEADVCVIGAGFSGLSVALECRARGLSVVVLDAHRPGWGA 64 Query: 68 SGRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGGV 127 SGRNGGQ + +++D +++ER +G A+ M+ EG ++RER+ Y I+CD G + Sbjct: 65 SGRNGGQTLVGFAKD-EIMERQLGLDGARAAWAMSVEGVSLVRERIEHYGIECDFTSGYL 123 Query: 128 FAALTAKQMGHLES-QKRLWERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHPL 186 A K++ L S + +R+G+T+L LD +R VA + Y+ G+ D GH+HPL Sbjct: 124 TVATKPKRVPDLRSWMESASQRWGYTKLSWLDTDEVRSRVASKRYLAGVYDPFSGHLHPL 183 Query: 187 NLALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPE 246 LG A A G ++ SP + + RGA PVV T +G+VR +F+ GNA +G+++P Sbjct: 184 KYCLGLADAARREGAQLFAHSPVIEVVRGARPVVRTARGEVRCRFVAACGNATIGDVLPA 243 Query: 247 -LAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVY 305 +AA+ P + ++ATEPLG E A +L+ + D N+ LDY+RL+ D R++FGG Sbjct: 244 AVAARIAPIASYIVATEPLGKERADALIKGREAICDNNFFLDYFRLSADHRVLFGGRASS 303 Query: 306 GARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCS 365 P + IR +M+ FPQL DVKIDYAW G +T +R P G + N +Y QG S Sbjct: 304 TGASPVQLGEEIRQRMIGVFPQLGDVKIDYAWGGFVDVTRNRAPDFGSIDPNYFYVQGFS 363 Query: 366 GHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYY 419 GHGV T +AG+V+A+A+ G+ + FD FA L H FPGG LR P +G Y+ Sbjct: 364 GHGVALTGIAGRVVAQAMAGETKAFDLFARLRHARFPGGPALRGPALELGMMYH 417 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 423 Length adjustment: 32 Effective length of query: 395 Effective length of database: 391 Effective search space: 154445 Effective search space used: 154445 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory