Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate BPHYT_RS34215 BPHYT_RS34215 oxidoreductase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__BFirm:BPHYT_RS34215 Length = 247 Score = 111 bits (277), Expect = 2e-29 Identities = 82/253 (32%), Positives = 125/253 (49%), Gaps = 22/253 (8%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAGIADVSKQAQ 71 G ++A GIGLA AE F A V D+ ID G+A +A+ Sbjct: 7 GKTALITAAGQGIGLATAELFAREGARVIATDIR---ID-----------GLAGKPVEAR 52 Query: 72 VDQIIDDARRK-----LGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLR 126 + DDA K +G +DVL N AG G + E W+ N+ + + +R Sbjct: 53 KLDVRDDAAIKALAAEIGAVDVLFNCAGFVH-AGNILECSEEDWDFAFDLNVKAMYRMIR 111 Query: 127 KAVPVLKETSDCASIIAMSSVAGRL-GYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVN 185 +P + + SII MSS A + G P R Y+++K A++GL KS+AA+ VR N Sbjct: 112 AFLPAMLDKGG-GSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCN 170 Query: 186 AILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPA 245 AI PG V +++ I A+A A G +A++ ++ + + R+ ++IAA+AL+L S Sbjct: 171 AICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDE 230 Query: 246 GSNVTGQAISVDG 258 S TG A +DG Sbjct: 231 SSFTTGHAHVIDG 243 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 247 Length adjustment: 24 Effective length of query: 239 Effective length of database: 223 Effective search space: 53297 Effective search space used: 53297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory