GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Burkholderia phytofirmans PsJN

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate BPHYT_RS25815 BPHYT_RS25815 deoxyribose-phosphate aldolase

Query= BRENDA::Q9Y315
         (318 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS25815 BPHYT_RS25815
           deoxyribose-phosphate aldolase
          Length = 336

 Score =  364 bits (935), Expect = e-105
 Identities = 186/314 (59%), Positives = 238/314 (75%), Gaps = 2/314 (0%)

Query: 5   NRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDT 64
           N G   D SW+  ++VN  AV RR   +  RR+VKK+ QAAWLLKAVT IDLTTL+GDDT
Sbjct: 25  NPGMPFDASWLDGLRVNQSAVERRTATLGTRRSVKKDAQAAWLLKAVTCIDLTTLNGDDT 84

Query: 65  SSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS 124
              ++RLC KA+ P+R DLL+AL +  +GITT AVCVY   V  AV AL  +G  IPVA+
Sbjct: 85  EGRVRRLCAKARQPVRADLLEALGLAPQGITTGAVCVYHRFVAAAVDALHGSG--IPVAA 142

Query: 125 VAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGE 184
           V+ GFPAG      +L+EI  +V DGA EID+V+ R  VLTG W+ALYDE+R FR ACG 
Sbjct: 143 VSTGFPAGLIPHPLKLKEIEASVADGAQEIDIVVTREYVLTGNWQALYDEVRDFRAACGP 202

Query: 185 AHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFF 244
           AHLKTILATG++ TL+NV +ASM+ MMAG+DFIKTSTGKE VNAT  V++VM+R IR++ 
Sbjct: 203 AHLKTILATGDIRTLSNVARASMVCMMAGADFIKTSTGKEGVNATLDVSLVMVRMIREYQ 262

Query: 245 WKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHH 304
            +TG  IGFKPAGG+ +AK  L++  L+KEELG  WL+PELFRIGAS+LL+DIERQ+ H+
Sbjct: 263 ERTGVLIGFKPAGGVSTAKSVLSYQILMKEELGRAWLEPELFRIGASSLLADIERQLEHY 322

Query: 305 VTGRYAAYHDLPMS 318
           V+GRY+A++  P++
Sbjct: 323 VSGRYSAFNRHPVA 336


Lambda     K      H
   0.320    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 323
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 336
Length adjustment: 28
Effective length of query: 290
Effective length of database: 308
Effective search space:    89320
Effective search space used:    89320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate BPHYT_RS25815 BPHYT_RS25815 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.28490.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
    1.1e-44  138.4   0.1    4.7e-44  136.4   0.1    1.8  1  lcl|FitnessBrowser__BFirm:BPHYT_RS25815  BPHYT_RS25815 deoxyribose-phosph


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS25815  BPHYT_RS25815 deoxyribose-phosphate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.4   0.1   4.7e-44   4.7e-44       3     202 ..      71     295 ..      69     300 .. 0.92

  Alignments for each domain:
  == domain 1  score: 136.4 bits;  conditional E-value: 4.7e-44
                                TIGR00126   3 akliDhtalkadtteedietlcaeAkky................kfaavcvnpsyvslAkelLkgtevei 56 
                                               + iD+t+l+ d+te  + +lca+A ++                 + avcv+ ++v  A++ L+g+ + +
  lcl|FitnessBrowser__BFirm:BPHYT_RS25815  71 VTCIDLTTLNGDDTEGRVRRLCAKARQPvradllealglapqgiTTGAVCVYHRFVAAAVDALHGSGIPV 140
                                              578**********************9988888888887777766788*********************** PP

                                TIGR00126  57 ctv.vgFPlGasttevkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilE 125
                                              ++v +gFP+G   +  kl E +++++ GA+E+D+v+    +  +n+++ +++++    ac+ ++lK il 
  lcl|FitnessBrowser__BFirm:BPHYT_RS25815 141 AAVsTGFPAGLIPHPLKLKEIEASVADGAQEIDIVVTREYVLTGNWQALYDEVRDFRAACGPAHLKTILA 210
                                              **978***************************************************************** PP

                                TIGR00126 126 talLtd.eekkkAseisieagadfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasGGvrta 187
                                              t+ ++  +++ +As +++ agadf+Ktstg+  ++At++   +m +++++        +g+K++GGv ta
  lcl|FitnessBrowser__BFirm:BPHYT_RS25815 211 TGDIRTlSNVARASMVCMMAGADFIKTSTGKEGVNATLDVSLVMVRMIREyqertgvLIGFKPAGGVSTA 280
                                              **997625666***************************99999999999999999999************ PP

                                TIGR00126 188 edalalieagaerig 202
                                              + +l++     e +g
  lcl|FitnessBrowser__BFirm:BPHYT_RS25815 281 KSVLSYQILMKEELG 295
                                              **9988666555555 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (336 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 2.98
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory