Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate BPHYT_RS26470 BPHYT_RS26470 MFS transporter
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__BFirm:BPHYT_RS26470 Length = 248 Score = 117 bits (293), Expect = 2e-31 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 14/248 (5%) Query: 15 VLISGAAAGIGAAIAQAFLDVGANVYIC---DVDPAAIDRA-RTAHPQLHAGVADVSDCA 70 VLI+GA GIG A A AF D GA + + +V+ A+++ R H ADV Sbjct: 6 VLITGALTGIGRATAFAFADSGARLVVSGRREVEGKALEKELRELGADAHFIQADVRRDD 65 Query: 71 QVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVP 130 +V ++D ++ G +D +NNAG G GA+ + T TN+ ++ + Sbjct: 66 EVANLVDQTVARFGRIDAAVNNAGTEGQPGAITSQTVESYSATFDTNVLGTLLSMKHELR 125 Query: 131 LLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPG 190 ++ + ++ ++S G G AF + YA SK A+ GM KS A+E+ VRVNA+ PG Sbjct: 126 VMSAQKSG-SVVNVSSTYGHEGAAFASVYAGSKHAVEGMTKSAALEVASTGVRVNAVAPG 184 Query: 191 VVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNIS 250 + +DR G + K K+ L R+ DVA +FLAS A I+ Sbjct: 185 PTDTGMLDRF---------TGTPENKAALAAKVPLGRVGQPVDVARAVVFLASEAASFIT 235 Query: 251 GQAISVDG 258 GQ ++VDG Sbjct: 236 GQILTVDG 243 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory