Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate BPHYT_RS01060 BPHYT_RS01060 alcohol dehydrogenase
Query= BRENDA::C7G3B8 (472 letters) >FitnessBrowser__BFirm:BPHYT_RS01060 Length = 417 Score = 401 bits (1031), Expect = e-116 Identities = 204/415 (49%), Positives = 273/415 (65%), Gaps = 21/415 (5%) Query: 30 DEDLIKKGEYVARLGDCVACHTSLNGQKYAGGLSIKTPIGTIYSTNITPDPTYGIGTYTF 89 D LI++G Y+A LGDC ACH + +G+ + GGL I TPIGT+Y+TNITPDP GIG YT Sbjct: 4 DTALIRRGAYLAVLGDCAACHVAKDGKAFVGGLPITTPIGTLYTTNITPDPATGIGNYTP 63 Query: 90 KEFDEAVRHGVRKDGATLYPAMPYPSFARMTQDDMKALYAYFMHGAQPIAQKNHPTDISW 149 +F+ AVR G+R+DG+ +YPAMPYPS+A ++ DD++ALYAYFMHG P+ N + I W Sbjct: 64 SDFERAVRRGIRRDGSPMYPAMPYPSYAHVSDDDVRALYAYFMHGVAPVDSPNRASGIPW 123 Query: 150 PMSMRWPLSIWRSVFAPAPKDFTPAPGTDAEIA-------------RGEYLVTGPGHCGA 196 P+SMRWPL+ WR FAP + PA TD + A RG YLV G HCG+ Sbjct: 124 PLSMRWPLTYWRWAFAPKVQ---PAAHTDIDSATAAGAAHDAALLERGRYLVEGLMHCGS 180 Query: 197 CHTPRGFGMQEKALDASGGPDFLGGGGVIDNWIAPSLRNDPVLGLGRWSDEDLFLFLKSG 256 CHTPRG G+QEKAL + G D+L GGVID+++A SLR D + GLGRWS D+ FL++G Sbjct: 181 CHTPRGVGLQEKALGDADGSDYL-SGGVIDHYVANSLRGDDLTGLGRWSQADIVEFLRTG 239 Query: 257 RTDHSAAFGGMADVVGWSTQYFTDADLHAMVKYIKSLPPVPPARGDYSYDASTAQMLDSN 316 R +AAFGGM DVV S+Q+ D DL A+ Y+KSLP PA G Y+Y A+ L Sbjct: 240 RNPETAAFGGMRDVVQHSSQFLNDTDLLAVATYLKSLPGNHPA-GHYAYAAAAGAALAKG 298 Query: 317 NISGNAGAKTYVDQCAICHRNDGGGVARMFPPLAGNPVVVSDNPTSVAHIVVDGGVLPPT 376 ++S GA Y++ CA CH + G G FP LAGNPVV + +PTS+ +IV++G T Sbjct: 299 DVSAR-GAIDYLNSCAACHLSSGKGYRDTFPALAGNPVVNAKDPTSLINIVLNGNTEVGT 357 Query: 377 NWAPSAVAMPDYKNILSDQQIADVVNFIRSAWGNRAPANTTAADIQKLRLD-HTP 430 + P+ MP + + L+D ++A+VV FIR++WGN AP + A ++ K+R H P Sbjct: 358 SRVPTQFTMPPFGDRLTDAEVANVVTFIRTSWGNHAP-DVNADEVAKVRAQTHAP 411 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 705 Number of extensions: 37 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 417 Length adjustment: 32 Effective length of query: 440 Effective length of database: 385 Effective search space: 169400 Effective search space used: 169400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory