Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate BPHYT_RS30785 BPHYT_RS30785 alcohol dehydrogenase
Query= BRENDA::C7G3B8 (472 letters) >FitnessBrowser__BFirm:BPHYT_RS30785 Length = 448 Score = 342 bits (878), Expect = 1e-98 Identities = 184/423 (43%), Positives = 249/423 (58%), Gaps = 11/423 (2%) Query: 11 GAVAVGLLAGTSLAHAQNADEDL-IKKGEYVARLGDCVACHTSLNGQKYAGGLSIKTPIG 69 GA++ G A TS A D + KG Y+A++GDC ACHT Q +AGGL + TP G Sbjct: 22 GALSSGANAQTSNATPTPVSADAQLAKGAYLAKVGDCAACHTVNKAQPFAGGLPLATPFG 81 Query: 70 TIYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDGATLYPAMPYPSFARMTQDDMKALYA 129 T+YSTNITPD + GIG Y++ +F A+R G+ KDG LYPAMPYPS+A++ DM ALY Sbjct: 82 TLYSTNITPDASTGIGGYSYADFATALRQGIAKDGHRLYPAMPYPSYAKIDDADMHALYR 141 Query: 130 YFMHGAQPIAQKNHPTDISWPMSMRWPLSIWRSVFAPAPKDFTPAPGTDAEIARGEYLVT 189 YFM G +PI Q + +++ +P ++R +++W ++A + P E RG YLV Sbjct: 142 YFMQGVKPIGQPDRASELRFPFNVRALMTVWDRLYAHEQLPYQADPHQSVEWNRGAYLVQ 201 Query: 190 GPGHCGACHTPRGFGMQEKALDASGGPDFLGGGGVIDNWIAPSLRNDPVLGLGR---WSD 246 G HCGACHTP G QE LD FL G + W AP+LR WS Sbjct: 202 GLAHCGACHTPHGMLGQESVLDEKDNTAFL-SGNTLAGWYAPNLRGHKTQTSDSDNVWSK 260 Query: 247 EDLFLFLKSGRTDHSAAFGGMADVVGWSTQYFTDADLHAMVKYIKSLP----PVPPARGD 302 DL +L+SGR AFG M +VV STQY D DL+A+ Y+ S P PPA Sbjct: 261 ADLVAYLRSGRMHDGVAFGPMTEVVDDSTQYLHDDDLNAIATYLTSPPLQAGATPPAPQQ 320 Query: 303 YSYDASTAQMLDSNNISGNAGAKTYVDQCAICHRNDGGGVARMFPPLAGNPVVVSDNPTS 362 TA L + + ++GA+ Y+D CA CHR DG G FP L GN V+S +P S Sbjct: 321 TGRAEQTAIALRAGRVD-SSGARLYLDNCAACHRTDGTGAMPAFPSLRGNASVLSGDPAS 379 Query: 363 VAHIVVDGGVLPPTNWAPSAVAMPDYKNILSDQQIADVVNFIRSAWGNRAPANTTAADIQ 422 + HIV+ G +P T AP+ +AMPD+ L+DQQ+AD+++F+R++WGNRA A TA ++ Sbjct: 380 LIHIVLSGSHMPSTAAAPTPLAMPDFGWRLTDQQVADLLSFVRTSWGNRAAA-VTAGEVA 438 Query: 423 KLR 425 K+R Sbjct: 439 KVR 441 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 714 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 448 Length adjustment: 33 Effective length of query: 439 Effective length of database: 415 Effective search space: 182185 Effective search space used: 182185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory