GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fba in Burkholderia phytofirmans PsJN

Align Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate BPHYT_RS16260 BPHYT_RS16260 fructose-bisphosphate aldolase

Query= SwissProt::Q56815
         (354 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS16260 BPHYT_RS16260
           fructose-bisphosphate aldolase
          Length = 354

 Score =  513 bits (1321), Expect = e-150
 Identities = 253/353 (71%), Positives = 298/353 (84%)

Query: 1   MALVSMRQLLDHAADDSYGLPAFNVNNMEQVKAIMDAARATSSPVILQGSAGARKYAGEP 60
           M LVSMRQLLDHAA++ YGLPAFNVNN+EQV+AIM AA   ++PVI+Q SAGARKYAGE 
Sbjct: 1   MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAIMAAADKVNAPVIMQASAGARKYAGEA 60

Query: 61  FLRHLIAAAVEAYPEIPVVMHQDHGASPAVCMGAIKSGFSSVMMDGSLKEDGKTPADYDY 120
           FLRHLI AAVE+YP IPVVMHQDHG SPAVCM AI+SGF+SVMMDGSL+ DGKT A Y+Y
Sbjct: 61  FLRHLIEAAVESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMMDGSLEADGKTVASYEY 120

Query: 121 NVSVTAKVVELAHAVGVSVEGELGCLGSLETGKGEAEDGHGAEEALDHSKLLTDPDEAAQ 180
           NV V+ KVVE AH++G++VE ELG LGSLET KG+ EDGHGAE  +   +LLTDP++AA 
Sbjct: 121 NVDVSRKVVEAAHSIGITVEAELGVLGSLETMKGDKEDGHGAEGTMTREQLLTDPEQAAD 180

Query: 181 FVKATQCDALAIAIGTSHGAYKFTRKPTGDILAIDRIKAIHQRIPTTHLVMHGSSSVPQE 240
           FVK TQCDALAIAIGTSHGAYKF++KPTGDIL+I RIK IHQRIP THLVMHGSSSVPQE
Sbjct: 181 FVKLTQCDALAIAIGTSHGAYKFSKKPTGDILSIQRIKEIHQRIPNTHLVMHGSSSVPQE 240

Query: 241 LLEEIRTYGGDIKETYGVPVEEIQEGIRYGVRKVNIDTDIRLAMTAAIRRVGAKNKSEFD 300
           LL EIR +GGD+KETYGVPVEEIQEGI+ GVRKVNIDTD+RLA+T AIRR  A N S+FD
Sbjct: 241 LLAEIREFGGDMKETYGVPVEEIQEGIKNGVRKVNIDTDLRLAITGAIRRYMATNPSKFD 300

Query: 301 PRKFMAAAMEEAKKVCIARFEAFGSAGKAEKIRAIELDEMAKRYASGELAQVV 353
           PR ++  A E A K+C+ R+  FG  G+A KI+ + LD++A++Y +GEL+QVV
Sbjct: 301 PRDYLKPAREAAMKICVERYTQFGCEGQAGKIKPVSLDKIAEKYKAGELSQVV 353


Lambda     K      H
   0.316    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 430
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 354
Length of database: 354
Length adjustment: 29
Effective length of query: 325
Effective length of database: 325
Effective search space:   105625
Effective search space used:   105625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate BPHYT_RS16260 BPHYT_RS16260 (fructose-bisphosphate aldolase)
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01521.hmm
# target sequence database:        /tmp/gapView.17186.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01521  [M=347]
Accession:   TIGR01521
Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
   2.4e-185  601.5   1.2   2.8e-185  601.3   1.2    1.0  1  lcl|FitnessBrowser__BFirm:BPHYT_RS16260  BPHYT_RS16260 fructose-bisphosph


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS16260  BPHYT_RS16260 fructose-bisphosphate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  601.3   1.2  2.8e-185  2.8e-185       1     347 []       3     349 ..       3     349 .. 1.00

  Alignments for each domain:
  == domain 1  score: 601.3 bits;  conditional E-value: 2.8e-185
                                TIGR01521   1 lislrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrklvlaavee 70 
                                              l+s+rqlldhaae+gyg+pafnvnnleq+ aim aadk ++pvi+qas+gar+yage++lr+l++aave 
  lcl|FitnessBrowser__BFirm:BPHYT_RS16260   3 LVSMRQLLDHAAENGYGLPAFNVNNLEQVQAIMAAADKVNAPVIMQASAGARKYAGEAFLRHLIEAAVES 72 
                                              69******************************************************************** PP

                                TIGR01521  71 ypdipvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaevvklahavgasvege 140
                                              yp+ipvv+hqdhg+spa+c++ai+ gftsvmmdgsl++d+kt a+y+ynv+v+ +vv+ ah++g++ve e
  lcl|FitnessBrowser__BFirm:BPHYT_RS16260  73 YPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMMDGSLEADGKTVASYEYNVDVSRKVVEAAHSIGITVEAE 142
                                              ********************************************************************** PP

                                TIGR01521 141 lgclgsletgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdalavaigtshgaykftrkptgevl 210
                                              lg lgslet kg++edghg+eg++ r qlltdpe+aa+fvk t+ dala+aigtshgaykf++kptg++l
  lcl|FitnessBrowser__BFirm:BPHYT_RS16260 143 LGVLGSLETMKGDKEDGHGAEGTMTREQLLTDPEQAADFVKLTQCDALAIAIGTSHGAYKFSKKPTGDIL 212
                                              ********************************************************************** PP

                                TIGR01521 211 aidrieeiherlpdthlvmhgsssvpqewldvineyggeiketygvpveeivkgikfgvrkvnidtdlrl 280
                                              +i+ri+eih+r+p+thlvmhgsssvpqe l+ i e+gg++ketygvpveei++gik gvrkvnidtdlrl
  lcl|FitnessBrowser__BFirm:BPHYT_RS16260 213 SIQRIKEIHQRIPNTHLVMHGSSSVPQELLAEIREFGGDMKETYGVPVEEIQEGIKNGVRKVNIDTDLRL 282
                                              ********************************************************************** PP

                                TIGR01521 281 aataalrrvaakdpsefdprkflkkaveamkdvckaryeafgtagnaskikvvsleemarryakgel 347
                                              a+t+a+rr +a++ps+fdpr +lk+a ea  ++c++ry +fg  g+a kik+vsl+++a++y  gel
  lcl|FitnessBrowser__BFirm:BPHYT_RS16260 283 AITGAIRRYMATNPSKFDPRDYLKPAREAAMKICVERYTQFGCEGQAGKIKPVSLDKIAEKYKAGEL 349
                                              *****************************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (347 nodes)
Target sequences:                          1  (354 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 6.98
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory