Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate BPHYT_RS28205 BPHYT_RS28205 ATPase
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__BFirm:BPHYT_RS28205 Length = 338 Score = 167 bits (422), Expect = 5e-46 Identities = 101/328 (30%), Positives = 174/328 (53%), Gaps = 10/328 (3%) Query: 21 LALPASRGKRARSELARLRELALLPALALLIVIGAFISPSFLTKANLISVLGASAALALV 80 +A P S + E E+ L+ L L + +G +SP FLT ANL +VL +AL+ Sbjct: 1 MAKPDSALLTRKRETPLQWEVLLVIVLILSLALGRLLSPVFLTGANLSNVLADLTEIALM 60 Query: 81 VLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGFGMQWPAAAGLLAIVVVGAVI 140 L +LI++ + DLS+ S +G + A+ +L + M P ++ ++V GA+ Sbjct: 61 ALPMTLIIVAAEIDLSVASVLGASSALMGVL--------WHMGLPMPLVIVLVLVAGALA 112 Query: 141 GFINGFLVVRLRLNAFIVTLAMLIVLRGMLVGATKGGTLFDMPTSFFALATTIVLG--LP 198 G +NG ++V+L L + VT+ L + RG+ + D P ++ A + G +P Sbjct: 113 GLLNGLVIVKLNLPSLAVTIGTLALFRGLAYVLLGDQAVADFPPAYTAFGMDTLGGSFIP 172 Query: 199 LSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGIRVERITWGVFVLGSILASV 258 L + + +L+ GR+LYAIG NP AA +GI V +I +FVL ++++ Sbjct: 173 LPFVIVIVGAIVFTVLLQSTAFGRSLYAIGANPTAAAFSGIEVAKIRLRLFVLSGAMSAL 232 Query: 259 GGLIVTGYVGAINANQGNGMIFTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLT 318 G++ T + + G G +V AA + GG+S+ GG+G+M G L +L++GV++N LT Sbjct: 233 AGVVYTLRFTSARGDNGEGFELSVIAAVLFGGVSIFGGRGSMIGVLLSLLIIGVLKNALT 292 Query: 319 LAQVPSFWIQAIYGAIILGSLMVARLAS 346 L V S + + G ++L S+++ L + Sbjct: 293 LDDVSSETLTIVTGVLLLASVLIPNLVA 320 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 338 Length adjustment: 29 Effective length of query: 322 Effective length of database: 309 Effective search space: 99498 Effective search space used: 99498 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory