Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate BPHYT_RS27975 BPHYT_RS27975 ABC transporter permease
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__BFirm:BPHYT_RS27975 Length = 318 Score = 159 bits (401), Expect = 1e-43 Identities = 93/287 (32%), Positives = 152/287 (52%), Gaps = 18/287 (6%) Query: 3 LSKLSAPTLLLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTN 62 LS + L +LP ++L + PLI++L SFT F+ P F+G NYV++LT+ Sbjct: 27 LSDRTIAWLFILPTVLLLLAINIFPLIWALRLSFTNFKSNMPSVPARFVGIDNYVDILTD 86 Query: 63 AEFWVAFGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQ 122 + W A T + ++ E+ LG GLALL+N+ G T ++ PMM SP +VG Sbjct: 87 EDIWYAMQVTARFVFWSVGLEVLLGFGLALLINRQFRGHSFWTTLILLPMMLSPAVVGNF 146 Query: 123 FKF-------LFNDNIGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAI 175 + F LFND +GF G+ + + D +LA ++I++ + W T + Sbjct: 147 WTFLLQPQTGLFNDIVGFFT------GIAPGSFQMIGDVSLAPWTIVMVDTWMWTPYVML 200 Query: 176 LILAGLLAMPKDPVEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKI 235 + LAGL ++P EAA VD TPW+ F +T P +PF +A+ R ++ + +D+V + Sbjct: 201 ICLAGLRSIPDYIYEAAEVDRATPWRQFWSITLPMTLPFLMLAVLFRGIENFKMFDMVNL 260 Query: 236 MTDGGPAKRTELLWTLIGRTAYGDARMGMANAMAYVAILLSIFFTVY 282 +T GGP TE + + R A+ + G ++A+A + +F TV+ Sbjct: 261 LTSGGPGSVTETVSITLKRAAFEKWQTGYSSALAII-----LFVTVF 302 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 318 Length adjustment: 27 Effective length of query: 271 Effective length of database: 291 Effective search space: 78861 Effective search space used: 78861 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory