Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate BPHYT_RS35660 BPHYT_RS35660 membrane protein
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__BFirm:BPHYT_RS35660 Length = 283 Score = 154 bits (390), Expect = 2e-42 Identities = 84/268 (31%), Positives = 144/268 (53%), Gaps = 11/268 (4%) Query: 26 MLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGVPVWDYFRNS 85 ++V+ P ++ ++L+P EI P W+P + M+ A G RNS Sbjct: 21 VVVVLFPFAVMLFTALKPASEIFVYPARWLPVHWQWSNFSDMWVAANFGVA-----LRNS 75 Query: 86 LIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLPLFML----- 140 ++S+ ST +ALA+ L YA AR+ F+ + ++T+ + I L + LF L Sbjct: 76 TVISLLSTALALAVSLPAAYALARFPFRGRGLYRQFLLVTQMLSPILLVVGLFRLAAMIP 135 Query: 141 YARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFWQVEF 200 Y ++D+ +I++Y A N+ F +W++ +F+ VP+DL E+A ++GC +A ++V Sbjct: 136 YGDGNLVDSKIGVIVSYAAFNIAFAVWMLSSYFQTVPRDLEESAWLEGCGRTKAVFKVFL 195 Query: 201 PLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTA-EFTIDWRGMCALA 259 PLA P I IF F+ +WNE+A+ + RS +KTL V + D A ++ + W + A Sbjct: 196 PLAVPAIVVTAIFTFINAWNEFAVVYTLIRSPENKTLTVQVTDMVAGKYVVQWHLVMAAT 255 Query: 260 VVMIVPALTLTFIIQKHLVSGLTFGAVK 287 + +P + +Q++LV GL GAVK Sbjct: 256 LCATLPVSVVFAWLQRYLVKGLALGAVK 283 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 283 Length adjustment: 26 Effective length of query: 262 Effective length of database: 257 Effective search space: 67334 Effective search space used: 67334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory