Align L-fucono-1,5-lactonase; D-arabinolactonase (characterized)
to candidate BPHYT_RS28220 BPHYT_RS28220 amidohydrolase
Query= reanno::Smeli:SM_b21101 (278 letters) >FitnessBrowser__BFirm:BPHYT_RS28220 Length = 297 Score = 124 bits (311), Expect = 2e-33 Identities = 89/296 (30%), Positives = 141/296 (47%), Gaps = 21/296 (7%) Query: 2 IIDTHLHLIDKSALNYPWLAGVPA--------LDRDFLYATYAAEAKRVGVAASLHMEVD 53 ++D+H+HL D YPWL L D+L EA + V +H+E + Sbjct: 3 VVDSHIHLWDLKTHRYPWLENPGVSFVGDARDLKHDYLLDDLLGEAGDIDVLKLVHVEAN 62 Query: 54 VDPAEIELETREVARLAGEPGS--LLKGAIAACRPEDEGFAAYLERQEENAFVKGFRRVL 111 DPA ETR + +A S + +AA A LE A +G R++L Sbjct: 63 HDPAAPVEETRWLQAIADRKESCGMPNAIVAAVDLSAPNAPAVLEAHASFANTRGVRQIL 122 Query: 112 HV--------VTDDLSEQPLFRENVKRLSGTRFTFDLCVLPHQIPKAIALADLAPDVQFI 163 +V V L + +RE+ L +FDL + P Q+ +A ALA D QF+ Sbjct: 123 NVHENKLFDYVGRHLMRERQWREHFALLRRYGMSFDLQLYPSQMEEAAALARAHGDTQFV 182 Query: 164 LDHCGVPDIKGHAE--HPWRDHMTEIARHPNVVAKISGVVAYAEEDWALDSIRPYVEHTI 221 ++H G+ +G WR+ M +A PN+ KISG+ + + W ++S+RPYV TI Sbjct: 183 INHAGMFVDRGSVAGYRAWREGMRLLADCPNIAVKISGLAMF-DHRWTVESLRPYVLETI 241 Query: 222 SVFGWDRVVWGSDWPVCTLGGNLSTWVAATQALIEGCSPQERRKLLSGNAQRIWNL 277 FG +R ++ S++PV L G+ + A +++E S E+ L NA+R + + Sbjct: 242 DTFGVERAMFASNFPVDRLFGSYADLWHAYASIVEVASVAEKEALFCRNAERCYRI 297 Lambda K H 0.321 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 297 Length adjustment: 26 Effective length of query: 252 Effective length of database: 271 Effective search space: 68292 Effective search space used: 68292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory