Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate BPHYT_RS30445 BPHYT_RS30445 ABC transporter substrate-binding protein
Query= SwissProt::P37735 (333 letters) >FitnessBrowser__BFirm:BPHYT_RS30445 Length = 347 Score = 132 bits (331), Expect = 2e-35 Identities = 82/256 (32%), Positives = 142/256 (55%), Gaps = 10/256 (3%) Query: 8 GALVGATALSLALSVPALAEPIVIKFSHVVA----PDTPKGKGAAKFEELAEKYTNGAVD 63 GA + A ++S A+A P +FS+ +A P P A + + TNG +D Sbjct: 20 GATLSAAVPLWSVSRRAMAAP---EFSYKLATGQDPTHPVNIRAQEAINHIREATNGRLD 76 Query: 64 VEVYPNSQLYKDKEELEALQLGAVQMLAPSLAKFGPLGVQDFEVFDLPYIFKDYEALHKV 123 ++++P +QL D + L ++ G V+ + + L + + + FKDY+A+ K Sbjct: 77 IKLFPQNQLGSDTDLLSQVRNGGVEFFNQASSILATL-TPAAGIVNTGFAFKDYDAVWKA 135 Query: 124 TQGEAGKMLLSKLEAKGITGLA-FWDNGFKIMSANT-PLTMPDDFLGLKMRIQSSKVLEA 181 G+ G + ++ G+ ++ WDNGF+ +S++T L P D G K+R+ + +L + Sbjct: 136 MDGDLGNYIRGQIGKSGLVSVSKVWDNGFRQISSSTRALRAPADLKGFKIRVPQAPMLTS 195 Query: 182 EMNALGAVPQVMAFSEVYQALQTGVVDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAV 241 AL A P + F+E+Y ALQTGVV+G ENP + T K+ EVQK+ ++++H + GY + Sbjct: 196 LFKALDAGPAPINFNELYSALQTGVVEGQENPLPIIATAKLYEVQKYISLTSHVWDGYWI 255 Query: 242 IVNKQFWDGLPADVRT 257 + N+ W+ LPA++RT Sbjct: 256 LGNRAAWERLPAEMRT 271 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 347 Length adjustment: 28 Effective length of query: 305 Effective length of database: 319 Effective search space: 97295 Effective search space used: 97295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory