Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate BPHYT_RS22780 BPHYT_RS22780 sugar ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >FitnessBrowser__BFirm:BPHYT_RS22780 Length = 283 Score = 182 bits (463), Expect = 6e-51 Identities = 100/266 (37%), Positives = 155/266 (58%), Gaps = 6/266 (2%) Query: 20 TLLLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWP---TVIDGIGWIKAWDVVGGYFWN 76 TL +A ++L+P++ +L+TS +S E++ GN WP + D + YFWN Sbjct: 20 TLPVALLIWLLPMIAVLVTSVRSTEELSEGNYWGWPKHFAMFDNYREALTTSPMLHYFWN 79 Query: 77 SVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPASFTLGKF 136 SV ITVPAV+ S + AM G+ L+++RFRG+ F + G F+P Q +++P + Sbjct: 80 SVLITVPAVVGSIALAAMAGFALAIYRFRGNSTLFATFVAGNFVPVQVLMIPVRDLSLQL 139 Query: 137 GLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTIFLKILLPMSI 196 GL NT + L+L HV + F LF RN+ +P LV+AAR++GA +T+F KI+LP+ Sbjct: 140 GLFNTVSALILFHVSFQTGFCALFLRNFIKQLPFELVEAARIEGANEWTVFFKIVLPLIR 199 Query: 197 PIVMVCLIWQFTQIWNDFLFGVVFASG-DAQPITVALNNLVNTSTGAKEYNVDMAAAMIA 255 P + I FT +WND+ + + G DA PITV + L T A +N+ A +++A Sbjct: 200 PALAALAILVFTFVWNDYFWALCLTQGDDAAPITVGVAALKGQWTTA--WNLVSAGSILA 257 Query: 256 GLPTLLVYIFAGKYFLRGLTSGAVKG 281 LP++ ++ K+F+ GLT GA KG Sbjct: 258 ALPSVAMFFAMQKHFVAGLTFGATKG 283 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory