Align Galactofuranose-binding protein YtfQ (characterized)
to candidate BPHYT_RS01825 BPHYT_RS01825 sugar ABC transporter substrate-binding protein
Query= SwissProt::P39325 (318 letters) >FitnessBrowser__BFirm:BPHYT_RS01825 Length = 339 Score = 202 bits (513), Expect = 1e-56 Identities = 118/280 (42%), Positives = 158/280 (56%), Gaps = 7/280 (2%) Query: 14 AMSSMALAAPLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVR 73 A+ +A PL VGF+Q S + WR AET K A K G L + D Q+ ++ Sbjct: 41 ALPKLASKTPLKVGFAQTESNNPWRLAETKSFKDIAAKCGWQLVMTDANSSNSKQVSDIQ 100 Query: 74 SFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSID---VKDKSLYMTTVTADN 130 + +AQ VD + P PV+ +AK A IPV L+DR +D K Y+T + +D Sbjct: 101 NMIAQHVDLLVFPPREEKPLAPVVLQAKKAGIPVILVDRDVDQSVAKAGRDYITFIGSDF 160 Query: 131 ILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGD 190 I +G DWLVK GK ++EL+GT GAS A DRKKGF E I P + II SQSGD Sbjct: 161 IDQGHRAADWLVKATGGK-AKIIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGD 219 Query: 191 FTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGV 250 F R KG++VME+ ++A ++ VYAHND+M +GAI AIK AG +PGKDI +IDG Sbjct: 220 FARDKGRQVMETLLQAH---PDVTAVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGT 276 Query: 251 PDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMP 290 A+ GE ASV+ +P A D ++Y K +P Sbjct: 277 KGGMDAIAAGELGASVQSSPFFGPLACDVAQRYAKGEKIP 316 Lambda K H 0.313 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 339 Length adjustment: 28 Effective length of query: 290 Effective length of database: 311 Effective search space: 90190 Effective search space used: 90190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory