Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate BPHYT_RS23880 BPHYT_RS23880 sugar ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__BFirm:BPHYT_RS23880 Length = 343 Score = 290 bits (741), Expect = 5e-83 Identities = 159/318 (50%), Positives = 217/318 (68%), Gaps = 10/318 (3%) Query: 13 KRRFRWPTGMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIG 72 +R WP V L+L+ ++ V PHF + + DG LFG+PID+LNRAAP+ L+A G Sbjct: 13 ERPLIWPC-----VTLVLLCGLNLWVNPHFLSLRMLDGHLFGAPIDVLNRAAPLVLVATG 67 Query: 73 MTLVIATGGIDLSVGAVMAIAGATTAAMTVA-----GFSLPIVLLSALGTGILAGLWNGI 127 MTLVIAT GID+SVGAV+AIAGA A + A + L++AL G+L+G+WNG+ Sbjct: 68 MTLVIATRGIDISVGAVVAIAGAAAATILAAQPEPSSALIAQALIAALIVGVLSGMWNGV 127 Query: 128 LVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVIIAVL 187 LV+ + +QP +ATLILMVAGRG+AQL+TAGQI+ +P + G G LL +P+ V IA + Sbjct: 128 LVSFVGMQPIIATLILMVAGRGIAQLLTAGQIIPIGAPGYLFVGGGYLLGVPSSVWIATV 187 Query: 188 TLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAAD 247 ++ L TALG+FI A+G+N A + G+ ++ +V Y SGL AA+AGI+++++ Sbjct: 188 AVLATAALVEGTALGLFIRAIGVNPVATRLVGLRSKALVFAVYGFSGLTAAMAGILISSN 247 Query: 248 IRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPE 307 +R AD NNAGL LELDAILAV +GG SL+GGRF+L +V+GALIIQ + G PPE Sbjct: 248 VRSADGNNAGLLLELDAILAVTLGGTSLLGGRFSLAGTVLGALIIQTLTYTTYSIGVPPE 307 Query: 308 MNQVVKAVVVLCVLIVQS 325 VVKA VVL V ++QS Sbjct: 308 ATLVVKAAVVLAVSVIQS 325 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 343 Length adjustment: 29 Effective length of query: 312 Effective length of database: 314 Effective search space: 97968 Effective search space used: 97968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory