Align L-talarate dehydratase (EC 4.2.1.156); galactarate dehydratase (EC 4.2.1.42) (characterized)
to candidate BPHYT_RS31620 BPHYT_RS31620 mandelate racemase
Query= BRENDA::Q8ZL58 (398 letters) >FitnessBrowser__BFirm:BPHYT_RS31620 Length = 373 Score = 135 bits (341), Expect = 1e-36 Identities = 100/313 (31%), Positives = 160/313 (51%), Gaps = 23/313 (7%) Query: 62 IIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGAS 121 +++ E+ + G G+G++YS ++ ++ + + +L D DI I+ ++ + Sbjct: 43 LVVVEVEAA-GQTGIGYTYSDKSLVTLVH---DALGECVLHSDVWDIRAIWQRMQRQVRN 98 Query: 122 VGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLK 181 +GRSG+A AIS D ALWD+KAK G+PL +LLGA R+SV Y SGGF T D+ ++ Sbjct: 99 LGRSGLAATAISATDCALWDLKAKLLGVPLVRLLGAARESVPLYG-SGGFT-TYSDKQMR 156 Query: 182 NVVIS--RENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRM 239 + +G +K+K+G + +D R+ R A+GD L VDAN + + A+ Sbjct: 157 EQLAGWVERDGCRWVKIKIG-TDPQKDPGRVETARAAIGDA-GLFVDANGAFTPQQALHW 214 Query: 240 GRKMEQFNLIWIEEPLDAYD------IEGHAQLAAALDTPIATGEMLTSFREHEQLILGN 293 ++ Q + W EEP+ + D + GHA IA GE + + QL+ Sbjct: 215 AQRFAQQRVEWFEEPVSSDDPAGLHFVRGHAPAG----MEIAAGEYGYTLDDFRQLLAAQ 270 Query: 294 ASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWL 353 + D +Q D R GGI+ F++ DL L+ H A +HLH++ A P L H EW Sbjct: 271 SVDVLQADVSRCGGITGFMQAADLCDAFHVPLSAHCAPALHLHVACAVPR---LRHQEWF 327 Query: 354 NPLFNEQLELRDG 366 + + L DG Sbjct: 328 HDHVRIESMLFDG 340 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 373 Length adjustment: 30 Effective length of query: 368 Effective length of database: 343 Effective search space: 126224 Effective search space used: 126224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory