Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate BPHYT_RS26220 BPHYT_RS26220 6-phosphogluconate dehydrogenase
Query= BRENDA::G5EBD7 (332 letters) >FitnessBrowser__BFirm:BPHYT_RS26220 Length = 345 Score = 332 bits (850), Expect = 1e-95 Identities = 173/344 (50%), Positives = 230/344 (66%), Gaps = 22/344 (6%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M++G+IGLGRMG ++ RLT+ G + +D V + V + + A +L D+ Sbjct: 1 MQLGMIGLGRMGADMVRRLTKGGQQCIAYD----VQPAAVEKLKQDGVPGAASLEDLVAQ 56 Query: 61 LEGDEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGIS 120 L D+ R VW+M+PA A+ + +++L LL GDI+IDGGN+YY DD+RR ELAE+ + Sbjct: 57 L--DKPRAVWLMVPA-AVVDMTLEKLVPLLEPGDIVIDGGNSYYHDDIRRGTELAERKLH 113 Query: 121 YVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPRA 180 YVDVGTSGGV G ERGYC+M GG E + ++PI + LAPG G P TPGR A Sbjct: 114 YVDVGTSGGVAGRERGYCLMIGGEPEVVKRLEPIFATLAPGAGSEPATPGR--VAGSSTA 171 Query: 181 EQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMK------------SKNSPILA- 227 +QG+LHCGP G+GHFVKMVHNGIEYGMM A+AEG +I+ ++ SP+ Sbjct: 172 DQGFLHCGPQGAGHFVKMVHNGIEYGMMAAYAEGLNILHHADAGKHAREADAETSPLRRP 231 Query: 228 EKDRFELNMGDIAEVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEAA 287 E +++LN+ D+ EVWRRGSV+SSWLLDL A +L L ++G V+DSGEGRWT+ AA Sbjct: 232 ELYQYDLNLADVTEVWRRGSVISSWLLDLIAGSLVSDVDLKNYAGRVSDSGEGRWTVAAA 291 Query: 288 IEEDVPAPVMTAALFTRFRSRSGNNFAEKILSAQRFGFGGHVEK 331 I+E VP PV++AALF RF SR +FA ++LSA R FGGH EK Sbjct: 292 IDEGVPTPVLSAALFARFSSRGEADFANRVLSAMRNDFGGHAEK 335 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 345 Length adjustment: 28 Effective length of query: 304 Effective length of database: 317 Effective search space: 96368 Effective search space used: 96368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS26220 BPHYT_RS26220 (6-phosphogluconate dehydrogenase)
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.28035.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-129 417.5 0.0 1.7e-129 417.3 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS26220 BPHYT_RS26220 6-phosphogluconate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS26220 BPHYT_RS26220 6-phosphogluconate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.3 0.0 1.7e-129 1.7e-129 1 298 [. 1 337 [. 1 338 [. 0.99 Alignments for each domain: == domain 1 score: 417.3 bits; conditional E-value: 1.7e-129 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedraegvanlkellkrlsaprvvwvmvpag 70 m+lg+iGlGrmGa++++rl+k+g ++++yd++++ave+lk+d+ g a+l++l+ +l+ pr vw+mvpa+ lcl|FitnessBrowser__BFirm:BPHYT_RS26220 1 MQLGMIGLGRMGADMVRRLTKGGQQCIAYDVQPAAVEKLKQDGVPGAASLEDLVAQLDKPRAVWLMVPAA 70 9********************************************************************* PP TIGR00872 71 ivdavleelapllekGdividgGnsyykdslrrekelkekgihlldvGtsGGvlGkerGyclmiGGdeea 140 +vd le+l plle GdividgGnsyy+d++rr el e+ +h++dvGtsGGv G+erGyclmiGG+ e+ lcl|FitnessBrowser__BFirm:BPHYT_RS26220 71 VVDMTLEKLVPLLEPGDIVIDGGNSYYHDDIRRGTELAERKLHYVDVGTSGGVAGRERGYCLMIGGEPEV 140 ********************************************************************** PP TIGR00872 141 fkkaeplfk.................dvaveekGylylGeaGsGhfvkmvhnGieyGlmaalaeGlevlk 193 k+ ep+f+ ++ ++G+l++G+ G+GhfvkmvhnGieyG+maa aeGl++l+ lcl|FitnessBrowser__BFirm:BPHYT_RS26220 141 VKRLEPIFAtlapgagsepatpgrvaGSSTADQGFLHCGPQGAGHFVKMVHNGIEYGMMAAYAEGLNILH 210 ***********************8887778899************************************* PP TIGR00872 194 ns......................qfdfdleevarvyrrGsvirsflldltakaleesadleeveGrved 241 ++ q+d +l +v++v+rrGsvi s+lldl+a +l + dl++ Grv+d lcl|FitnessBrowser__BFirm:BPHYT_RS26220 211 HAdagkhareadaetsplrrpelyQYDLNLADVTEVWRRGSVISSWLLDLIAGSLVSDVDLKNYAGRVSD 280 ********************************************************************** PP TIGR00872 242 sGeGrwtvkaavdlgvpapvlatslqerfasrekddfankvlaalrkefGghaekkk 298 sGeGrwtv aa+d+gvp+pvl+ +l rf+sr + dfan+vl+a+r++fGghaek + lcl|FitnessBrowser__BFirm:BPHYT_RS26220 281 SGEGRWTVAAAIDEGVPTPVLSAALFARFSSRGEADFANRVLSAMRNDFGGHAEKAA 337 *****************************************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.00 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory