Align ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS24175 BPHYT_RS24175 C4-dicarboxylate ABC transporter
Query= uniprot:A0A165IVH1 (339 letters) >FitnessBrowser__BFirm:BPHYT_RS24175 Length = 330 Score = 151 bits (382), Expect = 2e-41 Identities = 95/287 (33%), Positives = 153/287 (53%), Gaps = 10/287 (3%) Query: 5 RRTLLAALSVAAI-TCSFQAAAQDFKPRIIRFGYGLNEVSNQGRATKLFAEEVEKASGGK 63 R +L+ A SV A+ T S QA R+ R + A K EE+ KA+GGK Sbjct: 9 RVSLIVAASVLALSTVSAQA-------RVFRVSDVHGDTYPTNMAVKHMGEEINKATGGK 61 Query: 64 MKVRAIGAAALGSDVQMQQALIGGAQEMMVGSTATLVGITKEMAIWDTPFLFNNAKEADV 123 V+ G +ALGS+ + GA +M + A I E I PFLF + Sbjct: 62 DSVKVFGNSALGSENDTIDQVRIGALDMARANGAAFNEIVPESMIPSLPFLFRDIDHFRK 121 Query: 124 VLDGPVGQKVMDKLQEKGLVGLVYWENGFRNLTNSKRPVNKLEDMDGIKLRVMQNNVFLD 183 V+ GP GQK++D + KG++ L ++E+G R++ +K+P++ DM G+K+RV +++ +D Sbjct: 122 VMYGPEGQKILDAFKAKGMIALTFYESGARSIY-TKKPIHTPADMKGLKVRVQPSDLMVD 180 Query: 184 SFKTLGANAVPLPFSELFTALETKTVDGQENPYNTILSSKFYEVQKYLTVTNHVYSPWIV 243 + +G P+PF+E++T L+T VD EN + +K +EV + T H +P ++ Sbjct: 181 EIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPVYSETQHSMTPEVL 240 Query: 244 LVSKKYWDGLSKAEQKVLLDAAKKSRD-FERQDTRAEADKALADLKG 289 + SKK WD L+ EQ+++ AA S +++ T EAD + KG Sbjct: 241 VFSKKVWDTLTPQEQEIIKKAAADSVPYYQKLWTAREADASKTVTKG 287 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 330 Length adjustment: 28 Effective length of query: 311 Effective length of database: 302 Effective search space: 93922 Effective search space used: 93922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory